Overview

  • Product name

  • Description

    Rabbit polyclonal to KLHL26
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human KLHL26 aa 366-615.
    Sequence:

    AGGQHLQYRSGEGAVDACYRYDPHLNRWLRLQAMQESRIQFQLNVLCGMV YATGGRNRAGSLASVERYCPRRNEWGYACSLKRRTWGHAGAASGGRLYIS GGYGISVEDKKALHCYDPVADQWEFKAPMSEPRVLHAMVGAGGRIYALGG RMDHVDRCFDVLAVEYYVPETDQWTSVSPMRAGQSEAGCCLLERKIYIVG GYNWRLNNVTGIVQVYNTDTDEWERDLHFPESFAGIACAPVLLPRAGTRR


    Database link: Q53HC5

  • Positive control

    • IHC-P: Human placenta and gastric cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230111 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Sequence similarities

    Contains 1 BACK (BTB/Kelch associated) domain.
    Contains 1 BTB (POZ) domain.
    Contains 6 Kelch repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • C630013N10Rik antibody
    • FLJ11078 antibody
    • Kelch like 26 (Drosophila) antibody
    • Kelch like protein 26 antibody
    • Kelch-like protein 26 antibody
    • KLH26_HUMAN antibody
    • KLHL26 antibody
    • Klkl26 antibody
    see all

Images

  • Paraffin-embedded human placenta tissue stained for KLHL26 using ab230111 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gastric cancer tissue stained for KLHL26 using ab230111 at 1/100 dilution in immunohistochemical analysis.

References

ab230111 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230111.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up