Overview

  • Product name

    Anti-KLHL29 antibody
  • Description

    Rabbit polyclonal to KLHL29
  • Host species

    Rabbit
  • Specificity

    ab201086 detects endogenous levels of KLHL29.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human KLHL29 aa 272-317. The exact sequence is proprietary.
    Sequence:

    ATLPSGAPATNGPPTTDSAHGLQMLRTIGVGKYEFTDPGHPREMLK


    Database link: Q96CT2

  • Positive control

    • HEK293T, rat PC12 and mouse sp20 cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab201086 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 94 kDa.

Target

Images

  • All lanes : Anti-KLHL29 antibody (ab201086)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : Rat PC12 whole cell lysate
    Lane 3 : Mouse sp20 whole cell lysate

    Predicted band size: 94 kDa

References

ab201086 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up