Overview

  • Product name

  • Description

    Rabbit polyclonal to KLHL7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken
  • Immunogen

    Recombinant fragment corresponding to Human KLHL7 aa 427-586 (internal sequence).
    Sequence:

    ANGLIYVCGGSLGNNVSGRVLNSCEVYDPATETWTELCPMIEARKNHGLV FVKDKIFAVGGQNGLGGLDNVEYYDIKLNEWKMVSPMPWKGVTVKCAAVG SIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSC ICVVDTCGANEETLET


    Database link: Q8IXQ5

  • Positive control

    • IHC-P: Human colon cancer and human heart tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab229971 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human heart tissue stained for KLHL7 using ab229971 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon cancer tissue stained for KLHL7 using ab229971 at 1/100 dilution in immunohistochemical analysis.

References

ab229971 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229971.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up