For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    klotho-antibody-ab203576.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Metabolism Energy Metabolism
Share by email

Anti-Klotho antibody (ab203576)

  • Datasheet
Submit a review Submit a question References (12)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Klotho antibody (ab203576)
  • Western blot - Anti-Klotho antibody (ab203576)
  • Western blot - Anti-Klotho antibody (ab203576)

Key features and details

  • Rabbit polyclonal to Klotho
  • Suitable for: IHC-P, WB
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Primary
Product image
FITC Anti-F4/80 antibody [CI:A3-1] (ab105155)
Primary
Product image
Anti-TXNIP antibody [EPR14774] (ab188865)
Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-Klotho antibody
    See all Klotho primary antibodies
  • Description

    Rabbit polyclonal to Klotho
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human Klotho aa 400-450 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    WIDLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDG V


    Database link: Q9UEF7
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Mouse kidney tissue.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 0.01% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Metabolism
    • Energy Metabolism
    • Developmental Biology
    • Post embryonic development
    • Aging
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Energy transfer pathways
    • Energy Metabolism

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Recombinant Protein

    • Recombinant human Klotho protein (Active) (ab84072)
  • Related Products

    • Recombinant human Klotho protein (Active) (ab84072)

Applications

Our Abpromise guarantee covers the use of ab203576 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 using a fluorescent secondary antibody).

WB 1/100 - 1/1000. Predicted molecular weight: 116 kDa.

Target

  • Function

    May have weak glycosidase activity towards glucuronylated steroids. However, it lacks essential active site Glu residues at positions 239 and 872, suggesting it may be inactive as a glycosidase in vivo. May be involved in the regulation of calcium and phosphorus homeostasis by inhibiting the synthesis of active vitamin D (By similarity). Essential factor for the specific interaction between FGF23 and FGFR1.
    The Klotho peptide generated by cleavage of the membrane-bound isoform may be an anti-aging circulating hormone which would extend life span by inhibiting insulin/IGF1 signaling.
  • Tissue specificity

    Present in cortical renal tubules (at protein level). Soluble peptide is present in serum and cerebrospinal fluid. Expressed in kidney, placenta, small intestine and prostate. Down-regulated in renal cell carcinomas, hepatocellular carcinomas, and in chronic renal failure kidney.
  • Involvement in disease

    Defects in KL are a cause of hyperphosphatemic familial tumoral calcinosis (HFTC) [MIM:211900]. A severe metabolic disorder that manifests with hyperphosphatemia and massive calcium deposits in the skin and subcutaneous tissues. Some patients manifest recurrent, transient, painful swellings of the long bones associated with the radiographic findings of periosteal reaction and cortical hyperostosis and absence of skin involvement.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 1 family. Klotho subfamily.
  • Domain

    Contains 2 glycosyl hydrolase 1 regions. However, the first region lacks the essential Glu active site residue at position 239, and the second one lacks the essential Glu active site residue at position 872.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Secreted and Cell membrane. Isoform 1 shedding leads to a soluble peptide.
  • Target information above from: UniProt accession Q9UEF7 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 9365 Human
    • Entrez Gene: 16591 Mouse
    • Omim: 604824 Human
    • SwissProt: Q9UEF7 Human
    • SwissProt: O35082 Mouse
    • Unigene: 524953 Human
    • Unigene: 6500 Mouse
    • Alternative names

      • Kl antibody
      • KLOT_HUMAN antibody
      • Klotho peptide antibody

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Klotho antibody (ab203576)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Klotho antibody (ab203576)

      Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse kidney tissue labeling Klotho with ab203576 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

    • Western blot - Anti-Klotho antibody (ab203576)
      Western blot - Anti-Klotho antibody (ab203576)
      Anti-Klotho antibody (ab203576) at 1/100 dilution + 293T cell lysate at 30 µg

      Secondary
      IRDye800CW Goat Anti-Rabbit IgG at 1/200000 dilution

      Predicted band size: 116 kDa
      Additional bands at: 148 kDa (possible glycosylated form)



      Klotho has several glycosylation sites, it looks like putative 116 kDa and the glycosylated form around 135 kDa are both correct.

    • Western blot - Anti-Klotho antibody (ab203576)
      Western blot - Anti-Klotho antibody (ab203576)
      Anti-Klotho antibody (ab203576) at 1/10000 dilution + Mouse kidney lysates at 1/300 dilution

      Secondary
      conjugated secondary antibody at 1/10000 dilution

      Predicted band size: 116 kDa

    Protocols

    • Western blot protocols
    • Immunohistochemistry protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (12)

    Publishing research using ab203576? Please let us know so that we can cite the reference in this datasheet.

    ab203576 has been referenced in 12 publications.

    • Chen Y  et al. Intermedin1-53 attenuates aging-associated vascular calcification in rats by upregulating sirtuin 1. Aging (Albany NY) 12:5651-5674 (2020). PubMed: 32229709
    • Kan WC  et al. Effect of osthole on advanced glycation end products-induced renal tubular hypertrophy and role of klotho in its mechanism of action. Phytomedicine 53:205-212 (2019). PubMed: 30668400
    • Romero A  et al. The angiotensin-(1-7)/Mas receptor axis protects from endothelial cell senescence via klotho and Nrf2 activation. Aging Cell 18:e12913 (2019). PubMed: 30773786
    • Zhang J  et al. Alpha-Klotho, a critical protein for lung health, is not expressed in normal lung. FASEB Bioadv 1:675-687 (2019). PubMed: 32123814
    • Liu Y  et al. MicroRNA-34a Promotes Renal Fibrosis by Downregulation of Klotho in Tubular Epithelial Cells. Mol Ther 27:1051-1065 (2019). PubMed: 30853453
    View all Publications for this product

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab203576.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.