Anti-Klotho antibody (ab203576)
Key features and details
- Rabbit polyclonal to Klotho
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-Klotho antibody
See all Klotho primary antibodies -
Description
Rabbit polyclonal to Klotho -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Synthetic peptide within Human Klotho aa 400-450 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
Sequence:WIDLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIKLDG V
Database link: Q9UEF7 -
Positive control
- Mouse kidney tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 0.01% BSA -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab203576 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. (or 1/50 - 1/200 using a fluorescent secondary antibody). |
|
WB | 1/100 - 1/1000. Predicted molecular weight: 116 kDa. |
Target
-
Function
May have weak glycosidase activity towards glucuronylated steroids. However, it lacks essential active site Glu residues at positions 239 and 872, suggesting it may be inactive as a glycosidase in vivo. May be involved in the regulation of calcium and phosphorus homeostasis by inhibiting the synthesis of active vitamin D (By similarity). Essential factor for the specific interaction between FGF23 and FGFR1.
The Klotho peptide generated by cleavage of the membrane-bound isoform may be an anti-aging circulating hormone which would extend life span by inhibiting insulin/IGF1 signaling. -
Tissue specificity
Present in cortical renal tubules (at protein level). Soluble peptide is present in serum and cerebrospinal fluid. Expressed in kidney, placenta, small intestine and prostate. Down-regulated in renal cell carcinomas, hepatocellular carcinomas, and in chronic renal failure kidney. -
Involvement in disease
Defects in KL are a cause of hyperphosphatemic familial tumoral calcinosis (HFTC) [MIM:211900]. A severe metabolic disorder that manifests with hyperphosphatemia and massive calcium deposits in the skin and subcutaneous tissues. Some patients manifest recurrent, transient, painful swellings of the long bones associated with the radiographic findings of periosteal reaction and cortical hyperostosis and absence of skin involvement. -
Sequence similarities
Belongs to the glycosyl hydrolase 1 family. Klotho subfamily. -
Domain
Contains 2 glycosyl hydrolase 1 regions. However, the first region lacks the essential Glu active site residue at position 239, and the second one lacks the essential Glu active site residue at position 872. -
Post-translational
modificationsN-glycosylated. -
Cellular localization
Secreted and Cell membrane. Isoform 1 shedding leads to a soluble peptide. - Information by UniProt
-
Database links
- Entrez Gene: 9365 Human
- Entrez Gene: 16591 Mouse
- Omim: 604824 Human
- SwissProt: Q9UEF7 Human
- SwissProt: O35082 Mouse
- Unigene: 524953 Human
- Unigene: 6500 Mouse
-
Alternative names
- Kl antibody
- KLOT_HUMAN antibody
- Klotho peptide antibody
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Klotho antibody (ab203576)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse kidney tissue labeling Klotho with ab203576 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
Anti-Klotho antibody (ab203576) at 1/100 dilution + 293T cell lysate at 30 µg
Secondary
IRDye800CW Goat Anti-Rabbit IgG at 1/200000 dilution
Predicted band size: 116 kDa
Additional bands at: 148 kDa (possible glycosylated form)Klotho has several glycosylation sites, it looks like putative 116 kDa and the glycosylated form around 135 kDa are both correct.
-
Anti-Klotho antibody (ab203576) at 1/10000 dilution + Mouse kidney lysates at 1/300 dilution
Secondary
conjugated secondary antibody at 1/10000 dilution
Predicted band size: 116 kDa
Protocols
Datasheets and documents
References (12)
ab203576 has been referenced in 12 publications.
- Chen Y et al. Intermedin1-53 attenuates aging-associated vascular calcification in rats by upregulating sirtuin 1. Aging (Albany NY) 12:5651-5674 (2020). PubMed: 32229709
- Kan WC et al. Effect of osthole on advanced glycation end products-induced renal tubular hypertrophy and role of klotho in its mechanism of action. Phytomedicine 53:205-212 (2019). PubMed: 30668400
- Romero A et al. The angiotensin-(1-7)/Mas receptor axis protects from endothelial cell senescence via klotho and Nrf2 activation. Aging Cell 18:e12913 (2019). PubMed: 30773786
- Zhang J et al. Alpha-Klotho, a critical protein for lung health, is not expressed in normal lung. FASEB Bioadv 1:675-687 (2019). PubMed: 32123814
- Liu Y et al. MicroRNA-34a Promotes Renal Fibrosis by Downregulation of Klotho in Tubular Epithelial Cells. Mol Ther 27:1051-1065 (2019). PubMed: 30853453