Overview

  • Product name

  • Description

    Rabbit polyclonal to KLRG1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human KLRG1 aa 60-195.
    Sequence:

    LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSH LLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSF VQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF


    Database link: Q96E93

  • Positive control

    • IHC-P: Human colon cancer and gastric cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells.
  • Tissue specificity

    Expressed specifically on natural killer (NK) cells and T-cells, mainly CD8 T-cells.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Domain

    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. Upon phosphorylation of ITIM motif KLRG1 associates with the two phosphatases PTPN11 and INPP5D.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2F1 Ag antibody
    • 2F1 antibody
    • C type lectin domain family 15 member A antibody
    • C-type lectin domain family 15 member A antibody
    • CLEC15A antibody
    • ITIM containing receptor MAFA L antibody
    • ITIM-containing receptor MAFA-L antibody
    • Killer cell lectin like receptor G1 antibody
    • Killer cell lectin like receptor subfamily G member 1 antibody
    • Killer cell lectin-like receptor subfamily G member 1 antibody
    • KLRG 1 antibody
    • KLRG1 antibody
    • KLRG1 protein antibody
    • KLRG1_HUMAN antibody
    • MAFA 2F1 antibody
    • MAFA antibody
    • MAFA L antibody
    • MAFA like antibody
    • MAFA like receptor antibody
    • MAFA-like receptor antibody
    • MAFAL antibody
    • Mast cell function associated antigen (ITIM containing) antibody
    • Mast cell function associated antigen antibody
    • Mast cell function-associated antigen 2F1 antibody
    • Mast cell function-associated antigen antibody
    • Mast cell function-associated antigen, rat, homolog of antibody
    • MGC13600 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for KLRG1 using ab235951 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gastric cancer tissue stained for KLRG1 using ab235951 at 1/100 dilution in immunohistochemical analysis.

References

ab235951 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up