Anti-ASH1L antibody [ASH5H03] (ab50981)
Key features and details
- Mouse monoclonal [ASH5H03] to ASH1L
- Suitable for: WB
- Reacts with: Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-ASH1L antibody [ASH5H03]
See all ASH1L primary antibodies -
Description
Mouse monoclonal [ASH5H03] to ASH1L -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Recombinant fragment
Predicted to work with: Human -
Immunogen
Recombinant fragment corresponding to Human ASH1L aa 1611-1728.
Sequence:IGSCRVSNPNSSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTL AGSQPTSDKPSQRPSESTNCSPTRKRSSSESTSSTVNGVPSRSPRLVASG DDSVDSLLQRMVQNEDQE
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.40
Preservative: 0.05% Sodium azide
Constituents: 0.812% Sodium chloride, 0.1312% Sodium phosphate, 0.0225% Potassium chloride, 1% BSA, 0.03% Potassium phosphate, PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
ab50981 was purified using protein G column chromatography from culture supernatant of hybridoma cultured in a medium containing bovine IgG-depleted (approximately 95%) fetal bovine serum -
Clonality
Monoclonal -
Clone number
ASH5H03 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab50981 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Notes |
---|
WB: Use at an assay dependent dilution. Predicted molecular weight: 330 kDa.
This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein.
Not yet tested in other applications.
Optimal dilutions/concentrations should be determined by the end user.
Target
-
Function
Histone methyltransferase. Probably methylates 'Lys-4' of histone H3, a specific tag for epigenetic transcriptional activation. -
Tissue specificity
Widely expressed, with highest level in brain, heart and kidney. -
Sequence similarities
Belongs to the histone-lysine methyltransferase family. SET2 subfamily.
Contains 3 A.T hook DNA-binding domains.
Contains 1 AWS domain.
Contains 1 BAH domain.
Contains 1 bromo domain.
Contains 1 PHD-type zinc finger.
Contains 1 post-SET domain.
Contains 1 SET domain. -
Cellular localization
Nucleus. Cell junction > tight junction. Chromosome. The relevance of tight junction localization is however unclear. - Information by UniProt
-
Database links
- Entrez Gene: 55870 Human
- Omim: 607999 Human
- SwissProt: Q9NR48 Human
- Unigene: 491060 Human
-
Alternative names
- Absent small and homeotic disks protein 1 homolog antibody
- Absent Small or Homeotic Like antibody
- Absent Small or Homeotic Like antibody
see all
Images
-
Anti-ASH1L antibody [ASH5H03] (ab50981) + Recombinant ASH1L (immunogen)
Predicted band size: 330 kDa
Observed band size: 35 kDa why is the actual band size different from the predicted?
This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein.
Datasheets and documents
-
Datasheet download
References (3)
ab50981 has been referenced in 3 publications.
- Wang J et al. Asymmetric Expression of LincGET Biases Cell Fate in Two-Cell Mouse Embryos. Cell 175:1887-1901.e18 (2018). PubMed: 30550787
- Atta H et al. Mutant MMP-9 and HGF gene transfer enhance resolution of CCl4-induced liver fibrosis in rats: role of ASH1 and EZH2 methyltransferases repression. PLoS One 9:e112384 (2014). Dot blot . PubMed: 25380300
- Perugorria MJ et al. Histone methyltransferase ASH1 orchestrates fibrogenic gene transcription during myofibroblast transdifferentiation. Hepatology 56:1129-39 (2012). WB . PubMed: 22488473