Overview

  • Product name

    Anti-KMT3C / SMYD2 antibody
    See all KMT3C / SMYD2 primary antibodies
  • Description

    Rabbit polyclonal to KMT3C / SMYD2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Pig
  • Immunogen

    Recombinant fragment corresponding to Human KMT3C/ SMYD2 aa 115-272.
    Sequence:

    KQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHL GFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVI VTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCEC QECTTKDK


    Database link: Q9NRG4

  • Positive control

    • IHC-P: Human testis and small intestine tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234862 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Protein-lysine N-methyltransferase that methylates both histones and non-histone proteins. Specifically methylates histone H3 'Lys-4' (H3K4me) and dimethylates histone H3 'Lys-36' (H3K36me2). Has also methyltransferase activity toward non-histone proteins such as p53/TP53 and RB1. Monomethylates 'Lys-370' of p53/TP53, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity of p53/TP53. Monomethylates 'Lys-860' of RB1/RB.
  • Sequence similarities

    Contains 1 MYND-type zinc finger.
    Contains 1 SET domain.
  • Cellular localization

    Cytoplasm > cytosol. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Histone methyltransferase SMYD2 antibody
    • HSKM B antibody
    • HSKM-B antibody
    • HSKMB antibody
    • KMT3C antibody
    • Lysine N-methyltransferase 3C antibody
    • MGC119305 antibody
    • N lysine methyltransferase SMYD2 antibody
    • N-lysine methyltransferase SMYD2 antibody
    • SET and MYND domain containing 2 antibody
    • SET and MYND domain containing protein 2 antibody
    • SET and MYND domain-containing protein 2 antibody
    • Smyd2 antibody
    • SMYD2_HUMAN antibody
    • Zinc finger MYND domain containing 14 antibody
    • ZMYND14 antibody
    see all

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for KMT3C / SMYD2 (green) using ab234862 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human testis tissue stained for KMT3C / SMYD2 using ab234862 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for KMT3C / SMYD2 using ab234862 at 1/100 dilution in immunohistochemical analysis.

References

ab234862 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234862.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up