Overview

  • Product name

    Anti-KMT4 / Dot1L antibody
    See all KMT4 / Dot1L primary antibodies
  • Description

    Rabbit polyclonal to KMT4 / Dot1L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human KMT4/ Dot1L aa 40-90 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    TIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLW K


    Database link: Q8TEK3

  • Positive control

    • Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab217296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Histone methyltransferase. Methylates 'Lys-79' of histone H3. Nucleosomes are preferred as substrate compared to free histones. Binds to DNA.
  • Sequence similarities

    Belongs to the class I-like SAM-binding methyltransferase superfamily. DOT1 family.
    Contains 1 DOT1 domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Disrupter of telomere silencing protein 1 antibody
    • DOT 1 antibody
    • DOT1 antibody
    • DOT1 like antibody
    • DOT1 like histone H3 methyltransferase (S. cerevisiae) antibody
    • DOT1 like histone H3 methyltransferase antibody
    • DOT1 like histone H3K79 methyltransferase antibody
    • DOT1 like protein antibody
    • DOT1, S. cerevisiae, homolog of antibody
    • DOT1-like protein antibody
    • DOT1L antibody
    • DOT1L_HUMAN antibody
    • EC 2.1.1.43 antibody
    • H3 K79 HMTase antibody
    • H3 lysine-79 specific antibody
    • H3-K79-HMTase antibody
    • Histone H3 K79 methyltransferase antibody
    • Histone H3 methyltransferase antibody
    • Histone H3 methyltransferase DOT1-like antibody
    • Histone H3-K79 methyltransferase antibody
    • Histone lysine N methyltransferase H3 lysine 79 specific antibody
    • Histone methyltransferase DOT1L antibody
    • Histone-lysine N-methyltransferase antibody
    • KIAA1814 antibody
    • KMT4 antibody
    • Lysine N methyltransferase 4 antibody
    • Lysine N-methyltransferase 4 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human kidney tissue labeling KMT4 / Dot1L with ab217296 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217296 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217296.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up