Overview

  • Product name
  • Description
    Rabbit polyclonal to KMT6 / EZH2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IP, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Pig, Xenopus laevis, Chimpanzee, Zebrafish, Rhesus monkey, Gorilla, Xenopus tropicalis
  • Immunogen

    Synthetic peptide within Human KMT6/ EZH2 aa 696-746. The exact sequence is proprietary. CAA64955.1
    Sequence:

    YAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEI P


    Database link: Q15910

  • Positive control
    • 293T, HeLa, Jurkat, and Mouse TCMK-1 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab186006 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 85 kDa.
IP Use at 2-10 µg/mg of lysate.
IHC-P Use at an assay dependent concentration.

Target

  • Function
    Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' and 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Compared to EZH2-containing complexes, it is more abundant in embryonic stem cells and plays a major role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1, CDKN2A and retinoic acid target genes.
  • Tissue specificity
    Expressed in many tissues. Overexpressed in numerous tumor types including carcinomas of the breast, colon, larynx, lymphoma and testis.
  • Sequence similarities
    Belongs to the histone-lysine methyltransferase family. EZ subfamily.
    Contains 1 SET domain.
  • Developmental stage
    Expression decreases during senescence of embryonic fibroblasts (HEFs). Expression peaks at the G1/S phase boundary.
  • Post-translational
    modifications
    Phosphorylated by AKT1. Phosphorylation by AKT1 reduces methyltransferase activity.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Enhancer of zeste 2 antibody
    • enhancer of zeste 2 polycomb repressive complex 2 subunit antibody
    • Enhancer of zeste homolog 2 (Drosophila) antibody
    • Enhancer of zeste homolog 2 antibody
    • Enhancer of zeste, Drosophila, homolog 2 antibody
    • ENX 1 antibody
    • Enx 1h antibody
    • ENX-1 antibody
    • ENX1 antibody
    • Enx1h antibody
    • EZH 2 antibody
    • EZH1 antibody
    • EZH2 antibody
    • EZH2_HUMAN antibody
    • EZH2b antibody
    • Histone-lysine N-methyltransferase EZH2 antibody
    • KMT 6 antibody
    • KMT6 antibody
    • KMT6A antibody
    • Lysine N-methyltransferase 6 antibody
    • MGC9169 antibody
    • WVS antibody
    • WVS2 antibody
    see all

Images

  • Lane 1 : Anti-KMT6 / EZH2 antibody (ab186006) at 1 µg
    Lanes 2-4 : Anti-KMT6 / EZH2 antibody (ab186006) at 1 µg/ml

    Lane 1 : 293T whole cell lysate
    Lane 2 : HeLa whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : Mouse TCMK-1 cells.lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 85 kDa


    Exposure time: 3 minutes
  • Mouse plasmacytoma tissue stained with ab186006 at a diltution of 1:1000 to detect EZH2.

  • Human ovarian tissue stained with ab186006 at a diltution of 1:1000 to detect EZH2.

  • Detection of KMT6 / EZH2 by Western Blot of Immunprecipitate.

    Lane 1: ab186006 at 1 µg/ml labeling KMT6 / EZH2 in 293T whole cell lysate immunoprecipitated using ab186006 at 6µg/mg lysate (1 mg/IP; 20% of IP loaded/lane).

    Lane 2: Control IgG


    Detection: Chemiluminescence with an exposure time of 3 minutes.

     

References

This product has been referenced in:
  • Chen Y  et al. Long noncoding RNA FOXC2-AS1 facilitates the proliferation and progression of prostate cancer via targeting miR-1253/EZH2. Gene 686:37-42 (2019). Read more (PubMed: 30389560) »
  • Shivram H  et al. MicroRNAs reinforce repression of PRC2 transcriptional targets independently and through a feed-forward regulatory network. Genome Res 29:184-192 (2019). Read more (PubMed: 30651280) »
See all 17 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186006.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up