AB50245
Human GLP-1 peptide is a Recombinant Fragment peptide. >95% and suitable for SDS-PAGE.
Reactivity 정보
{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }
서열 정보
[{"linker":null,"sequence":"HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":37,"aminoAcidStart":7,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P01275","tags":[]}]
특성 및 보관 정보
제형
Lyophilized
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False
타겟 정보
Glucagon. Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes. Binds to and activates the glucagon receptor GCGR, which couples to the G(s) G protein and elevates intracellular cAMP, triggering downstream metabolic responses (PubMed : 32193322).. Glucagon-like peptide 1. Potent stimulator of glucose-dependent insulin release (PubMed : 22037645, PubMed : 40446798). Also stimulates insulin release in response to IL6 (PubMed : 22037645). Plays important roles on gastric motility and the suppression of plasma glucagon levels (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). Has growth-promoting activities on intestinal epithelium (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferation (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). Inhibits beta cell apoptosis (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744).. Glucagon-like peptide 2. Stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability.. Oxyntomodulin. Significantly reduces food intake. Inhibits gastric emptying in humans. Suppression of gastric emptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness.. Glicentin. May modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life.
대체 명칭 보기
Pro-glucagon, GCG
제품이 사용된 논문 (2)
Recent publications for all applications. Explore the 전체 목록and refine your search
Fish physiology and biochemistry 39:1555-65 PubMed23748963
2013
Enteroendocrine profile of α-transducin immunoreactive cells in the gastrointestinal tract of the European sea bass (Dicentrarchus labrax).
Applications
Unspecified application
Species
Unspecified reactive species
Rocco Latorre,Maurizio Mazzoni,Roberto De Giorgio,Claudia Vallorani,Alessio Bonaldo,Pier Paolo Gatta,Roberto Corinaldesi,Eugenio Ruggeri,Chiara Bernardini,Roberto Chiocchetti,Catia Sternini,Paolo Clavenzani
Proceedings of the National Academy of Sciences of 109:3915-20 PubMed22345561
2012
Adenosine kinase inhibition selectively promotes rodent and porcine islet β-cell replication.
Applications
Unspecified application
Species
Unspecified reactive species
Justin P Annes,Jennifer Hyoje Ryu,Kelvin Lam,Peter J Carolan,Katrina Utz,Jennifer Hollister-Lock,Anthony C Arvanites,Lee L Rubin,Gordon Weir,Douglas A Melton
Product promise
저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.
Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.
For licensing inquiries, please contact partnerships@abcam.com