JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB220535

Recombinant cynomolgus monkey LDL Receptor protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant cynomolgus monkey LDL Receptor protein (Active) is a Human Fragment protein, in the 22 to 788 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

대체 명칭 보기

Low-density lipoprotein receptor, LDL receptor, LDLR

3 Images
Functional Studies - Recombinant cynomolgus monkey LDL Receptor protein (Active) (AB220535)
  • FuncS

Supplier Data

Functional Studies - Recombinant cynomolgus monkey LDL Receptor protein (Active) (AB220535)

Immobilized Cynomolgus PCSK9, His Tag at 10 μg/ml (100 μl/well) can bind ab220535 with a linear range of 0.04-0.256 μg/ml.

Functional Studies - Recombinant cynomolgus monkey LDL Receptor protein (Active) (AB220535)
  • FuncS

Supplier Data

Functional Studies - Recombinant cynomolgus monkey LDL Receptor protein (Active) (AB220535)

Immobilized ab220535 at 2 μg/ml (100 μl/well) can bind Biotinylated Human PCSK9, His Tag with a linear range of 0.007-0.256 μg/ml.

SDS-PAGE - Recombinant cynomolgus monkey LDL Receptor protein (Active) (AB220535)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant cynomolgus monkey LDL Receptor protein (Active) (AB220535)

SDS-PAGE analysis of ab220535 stained overnight with Coomassie Blue.

The protein migrates as 135-155 kDa under reducing conditions due to glycosylation.

주요 정보

Purity

>95% SDS-PAGE

Endotoxin 레벨

< 1 EU/µg

발현 시스템

HEK 293 cells

Tags

His tag C-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Measured by its binding ability in a functional ELISA. Immobilized ab220535 at 2 μg/ml (100 μl/well) can bind Biotinylated Human PCSK9, His Tag with a linear range of 0.007-0.256 μg/ml.

Immobilized Cynomolgus PCSK9, His Tag at 10 μg/ml (100 μl/well) can bind ab220535 with a linear range of 0.04-0.256 μg/ml.

Accession

P01130

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute at 200 µg/mL in water

보관 버퍼

pH: 7.4 Constituents: PBS, 5% Trehalose

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"sequence":"AVGDRCERNEFQCEDGKCISYKWVCDGTAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGEVDCENGSDEQDCPPKTCSQDEFRCHDGKCIYRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQHCQGLEVPKRDSSPCSAFEFHCRSGECIHSGWRCDGGPDCKDKSDEENCPVATCRPDEFQCSDGTCIHGSRQCDREYDCKDMSDEVGCINVTLCEGPNKFKCHSGECISLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHICNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGSYKCQCEEGFQLDPHTKACKAVGSIAYLIFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMIYSTQLDRAHSVSSYDTVISRDLQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIEWPNGITLDFPSGRLYWVDSKLHSISSIDVNGGNRKTVLEDKERLAHPFSLAIFEDKVFWTDIINEAIFSANRLTGSDINLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPQSPKFTCTCPDGMLLAKDMRSCLTEAEAAVATQETSTVRLMVSSKAVATQHTTTRPVPNTSQLPGATPGLTTAETVTMSHQALGDVAGRGNEKKPKSVG","proteinLength":"Fragment","predictedMolecularWeight":"86.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":788,"aminoAcidStart":22,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":null,"tags":[{"tag":"His","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
보관 정보
Avoid freeze / thaw cycle
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

The LDL Receptor also called LDLR is a protein that plays an important role in the uptake and clearance of low-density lipoproteins (LDL) from the bloodstream. LDLR binds LDL particles facilitating their internalization through receptor-mediated endocytosis. This receptor is expressed mainly in the liver adrenal glands and other tissues involved in cholesterol metabolism. It has an approximate molecular weight of 160 kDa. Researchers often study LDLR using techniques like Western blotting to understand its presence and function.
Biological function summary

The LDL receptor interacts with LDL particles to regulate cholesterol levels in the body. It is part of a cell surface complex that recognizes and binds to apolipoprotein B-100 or apolipoprotein E present on LDL. This interaction initiates internalization of LDL leading to its degradation in lysosomes where cholesterol can be released and used by the cell. Mutations in the gene encoding LDLR can lead to inefficient cholesterol uptake influencing various metabolic processes.

Pathways

LDL receptor activities are integral to lipid metabolism and cholesterol homeostasis. Two important biological pathways that involve LDLR include the cholesterol biosynthesis pathway and the lipoprotein clearance pathway. Within these pathways LDLR collaborates closely with proteins like PCSK9 which modulates its expression and degradation and HMG-CoA reductase an important enzyme in cholesterol synthesis to balance cholesterol levels in the body.

Defects in the LDL receptor are strongly associated with familial hypercholesterolemia and atherosclerosis. These conditions arise from impaired clearance of LDL leading to elevated cholesterol levels which pose risks for cardiovascular diseases. LDLR dysfunctions are linked with the Protein PCSK9 whose gain-of-function mutations can exacerbate hypercholesterolemia by promoting degradation of LDLR while statins aim to increase LDLR expression to lower LDL cholesterol levels.

일반 정보

기능

Binds low density lipoprotein /LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. In order to be internalized, the receptor-ligand complexes must first cluster into clathrin-coated pits. Forms a ternary complex with PGRMC1 and TMEM97 receptors which increases LDLR-mediated LDL internalization (PubMed : 30443021).. (Microbial infection) Acts as a receptor for hepatitis C virus in hepatocytes, but not through a direct interaction with viral proteins.. (Microbial infection) Acts as a receptor for Vesicular stomatitis virus.. (Microbial infection) In case of HIV-1 infection, may function as a receptor for extracellular Tat in neurons, mediating its internalization in uninfected cells.. (Microbial infection) Acts as a receptor for Crimean-Congo hemorrhagic fever virus (CCHFV).. (Microbial infection) Acts as a receptor for many Alphavirus, including Getah virus (GETV), Ross river virus (RRV) and Semliki Forest virus.

서열 유사성

Belongs to the LDLR family.

Post-translational modifications

N- and O-glycosylated.. Ubiquitinated by MYLIP leading to degradation.

제품 프로토콜

타겟 정보

Binds low density lipoprotein /LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. In order to be internalized, the receptor-ligand complexes must first cluster into clathrin-coated pits. Forms a ternary complex with PGRMC1 and TMEM97 receptors which increases LDLR-mediated LDL internalization (PubMed : 30443021).. (Microbial infection) Acts as a receptor for hepatitis C virus in hepatocytes, but not through a direct interaction with viral proteins.. (Microbial infection) Acts as a receptor for Vesicular stomatitis virus.. (Microbial infection) In case of HIV-1 infection, may function as a receptor for extracellular Tat in neurons, mediating its internalization in uninfected cells.. (Microbial infection) Acts as a receptor for Crimean-Congo hemorrhagic fever virus (CCHFV).. (Microbial infection) Acts as a receptor for many Alphavirus, including Getah virus (GETV), Ross river virus (RRV) and Semliki Forest virus.
See full target information Low-density lipoprotein receptor

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com