JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB53869

Recombinant Human 14-3-3 gamma/YWHAG protein (Tag Free)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human 14-3-3 gamma/YWHAG protein (Tag Free) is a Human Full Length protein, in the 1 to 247 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.
1 이미지
SDS-PAGE - Recombinant Human 14-3-3 gamma/YWHAG protein (Tag Free) (AB53869)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human 14-3-3 gamma/YWHAG protein (Tag Free) (AB53869)

3ug by SDS-PAGE under reducing conditions and visualized by coomassie blue stain.

주요 정보

Purity

>95% SDS-PAGE

Recombinant human 14-3-3 was expressed in E.coli and purified by using conventional chromatography techniques.

Endotoxin 레벨

< 1 EU/µg

발현 시스템

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P61981-1

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

This product was previously labelled as 14-3-3 gamma.

서열 정보

[{"linker":null,"sequence":"MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN","proteinLength":"Full Length","predictedMolecularWeight":"28 kDa","actualMolecularWeight":null,"aminoAcidEnd":247,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P61981","tags":[]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

14-3-3 gamma also known as YWHAG or 14-3-3 gamma protein is a member of the 14-3-3 protein family. These proteins play significant roles in signal transduction. 14-3-3 gamma is a dimeric protein with a molecular mass of about 28 to 32 kDa per monomer. It is ubiquitously expressed including in tissues such as brain muscle and heart. This protein influences a wide range of cellular processes by interacting with various signaling proteins often through recognition of phosphorylated serine or threonine motifs.
Biological function summary

Proteins within the 14-3-3 family like the 14-3-3 gamma function as adaptors and scaffolds in signal transduction pathways. They are part of multi-protein complexes that modulate interactions among proteins within the cell. 14-3-3 gamma interacts dynamically with a variety of target proteins assisting in their activities and proper localization. Its interaction facilitates cellular processes including cell cycle control apoptosis and stress response owing to its activity as a regulator of distinct signaling pathways.

Pathways

14-3-3 gamma participates in the MAPK/ERK pathway which is pivotal for cell growth and differentiation. It also plays an integral role in the PI3K/AKT pathway which contributes to survival and proliferation signals. In these pathways 14-3-3 gamma interacts with important kinases such as Raf and AKT. These interactions help transduce signals from receptors on the cell surface to the nucleus impacting gene expression and cellular responses.

Research has linked 14-3-3 gamma to neurodegenerative diseases such as Alzheimer's disease. In Alzheimer's 14-3-3 gamma interacts with proteins like tau which become abnormally phosphorylated and aggregate. Additionally this protein has associations with certain cancers where it might influence tumor growth and progression through interactions with cell cycle regulatory proteins. Its modulation of key signaling pathways makes it a candidate of interest in the development of therapeutic strategies for these diseases.

일반 정보

기능

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways (PubMed : 15696159, PubMed : 16511572, PubMed : 36732624). Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif (PubMed : 15696159, PubMed : 16511572, PubMed : 36732624). Binding generally results in the modulation of the activity of the binding partner (PubMed : 16511572). Promotes inactivation of WDR24 component of the GATOR2 complex by binding to phosphorylated WDR24 (PubMed : 36732624). Participates in the positive regulation of NMDA glutamate receptor activity by promoting the L-glutamate secretion through interaction with BEST1 (PubMed : 29121962). Reduces keratinocyte intercellular adhesion, via interacting with PKP1 and sequestering it in the cytoplasm, thereby reducing its incorporation into desmosomes (PubMed : 29678907). Plays a role in mitochondrial protein catabolic process (also named MALM) that promotes the degradation of damaged proteins inside mitochondria (PubMed : 22532927).

서열 유사성

Belongs to the 14-3-3 family.

Post-translational modifications

Phosphorylated by various PKC isozymes.

Subcellular localisation

Mitochondrion matrix

제품 프로토콜

타겟 정보

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways (PubMed : 15696159, PubMed : 16511572, PubMed : 36732624). Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif (PubMed : 15696159, PubMed : 16511572, PubMed : 36732624). Binding generally results in the modulation of the activity of the binding partner (PubMed : 16511572). Promotes inactivation of WDR24 component of the GATOR2 complex by binding to phosphorylated WDR24 (PubMed : 36732624). Participates in the positive regulation of NMDA glutamate receptor activity by promoting the L-glutamate secretion through interaction with BEST1 (PubMed : 29121962). Reduces keratinocyte intercellular adhesion, via interacting with PKP1 and sequestering it in the cytoplasm, thereby reducing its incorporation into desmosomes (PubMed : 29678907). Plays a role in mitochondrial protein catabolic process (also named MALM) that promotes the degradation of damaged proteins inside mitochondria (PubMed : 22532927).
See full target information YWHAG

대체 명칭 보기

14-3-3 protein gamma, Protein kinase C inhibitor protein 1, KCIP-1, YWHAG

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com