JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB310800

Recombinant Human Adiponectin protein

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Adiponectin protein is a Human Fragment protein, in the 19 to 244 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, Mass Spec, HPLC.

대체 명칭 보기

ACDC, ACRP30, APM1, GBP28, ADIPOQ, Adiponectin, 30 kDa adipocyte complement-related protein, Adipocyte complement-related 30 kDa protein, Adipose most abundant gene transcript 1 protein, Gelatin-binding protein, apM-1

4 이미지
Mass Spectrometry - Recombinant Human Adiponectin protein (AB310800)
  • Mass Spec

Lab

Mass Spectrometry - Recombinant Human Adiponectin protein (AB310800)

Mass determination by ESI-TOF. Predicted MW is 24601.56538 (+/- 10Da by ESI-TOF). Observed MW is 24805.22.

SDS-PAGE - Recombinant Human Adiponectin protein (AB310800)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Adiponectin protein (AB310800)

SDS-PAGE analysis of ab310800

SDS-PAGE - Recombinant Human Adiponectin protein (AB310800)
  • SDS-PAGE

Lab

SDS-PAGE - Recombinant Human Adiponectin protein (AB310800)

SDS-PAGE analysis of ab310800

HPLC - Recombinant Human Adiponectin protein (AB310800)
  • HPLC

Lab

HPLC - Recombinant Human Adiponectin protein (AB310800)

HPLC analysis of ab310800

주요 정보

Purity

>95% HPLC

SDS-PAGE >= 95%

Endotoxin 레벨

<0.005 EU/µg

발현 시스템

HEK 293 cells

Tags

Tag free

Applications

HPLC, Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product. Store lyophilized form at room temperature. Reconstitute in phosphate buffered saline, aliquot and store at -80°C for 12 months or +4°C for 1 week. Avoid repeated freeze-thaw.

보관 버퍼

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN","proteinLength":"Fragment","predictedMolecularWeight":"24.6 kDa","actualMolecularWeight":"24.8 kDa","aminoAcidEnd":244,"aminoAcidStart":19,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q15848","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Adiponectin also known as ADIPOQ or adipocyte complement-related protein of 30 kDa (Acrp30) is a 30 kDa protein that plays a significant mechanical role in energy homeostasis. Adiponectin is secreted predominantly by adipose tissue and circulates in the blood. This protein forms various multimeric structures including low-molecular-weight medium-molecular-weight and high-molecular-weight forms each with distinct biological functions. Its expression in adipose tissue links it closely to metabolic processes and functions related to fat storage and energy balance.
Biological function summary

Adiponectin influences glucose regulation and fatty acid oxidation. It acts as a hormone with several metabolic roles including anti-diabetic anti-atherogenic and anti-inflammatory properties. Adiponectin participates in forming a complex with other proteins such as AdipoR1 and AdipoR2 which are receptors facilitating signal transduction. The interaction of adiponectin with its receptors leads to the induction of several lipid and glucose metabolism pathways important for maintaining cellular energy balance.

Pathways

Many regulatory cascades are influenced by adiponectin. This protein is integral to the AMPK signaling pathway and the PPAR signaling pathway. In the AMPK pathway adiponectin enhances insulin sensitivity and stimulates oxidation of fatty acids in muscle tissue. Through the PPAR pathway it influences lipid metabolism and storage. Adiponectin interacts with key proteins such as leptin and resistin coordinating various metabolic pathways to balance energy and glucose levels making it a critical factor in metabolic regulation.

Reduced levels of adiponectin associate with conditions like type 2 diabetes and cardiovascular disease. Lower circulating adiponectin concentrations correlate with obesity leading to increased insulin resistance and higher risk of type 2 diabetes. In cardiovascular disease this protein's role links to its anti-inflammatory properties and ability to decrease the proliferation of vascular smooth muscle cells. Adiponectin also interacts with proteins like cytokines that play a role in these conditions affecting the body's inflammatory responses and metabolic processes highlighting its importance in health and disease management.

일반 정보

기능

Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.

Post-translational modifications

HMW complexes are more extensively glycosylated than smaller oligomers. Hydroxylation and glycosylation of the lysine residues within the collagen-like domain of adiponectin seem to be critically involved in regulating the formation and/or secretion of HMW complexes and consequently contribute to the insulin-sensitizing activity of adiponectin in hepatocytes.. O-glycosylated. Not N-glycosylated. O-linked glycans on hydroxylysines consist of Glc-Gal disaccharides bound to the oxygen atom of post-translationally added hydroxyl groups. Sialylated to varying degrees depending on tissue. Thr-22 appears to be the major site of sialylation. Higher sialylation found in SGBS adipocytes than in HEK fibroblasts. Sialylation is not required neither for heterodimerization nor for secretion. Not sialylated on the glycosylated hydroxylysines. Desialylated forms are rapidly cleared from the circulation.. Succination of Cys-36 by the Krebs cycle intermediate fumarate, which leads to S-(2-succinyl)cysteine residues, inhibits polymerization and secretion of adiponectin. Adiponectin is a major target for succination in both adipocytes and adipose tissue of diabetic mammals. It was proposed that succination of proteins is a biomarker of mitochondrial stress and accumulation of Krebs cycle intermediates in adipose tissue in diabetes and that succination of adiponectin may contribute to the decrease in plasma adiponectin in diabetes.

제품 프로토콜

타겟 정보

Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
See full target information ADIPOQ

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com