JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276417

Recombinant Human Adrenomedullin/ADM protein (Fc Chimera)

Be the first to review this product! 리뷰 제출

|

(1 출판물)

Recombinant Human Adrenomedullin/ADM protein (Fc Chimera) is a Human Fragment protein, in the 95 to 146 aa range, expressed in HEK 293 cells, with >93%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

대체 명칭 보기

AM, ADM, Pro-adrenomedullin

1 이미지
SDS-PAGE - Recombinant Human Adrenomedullin/ADM protein (Fc Chimera) (AB276417)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Adrenomedullin/ADM protein (Fc Chimera) (AB276417)

SDS-PAGE analysis of ab276417

주요 정보

Purity

>93% SDS-PAGE

Endotoxin 레벨

< 1 EU/µg

발현 시스템

HEK 293 cells

Tags

Fc tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY","proteinLength":"Fragment","predictedMolecularWeight":"38 kDa","actualMolecularWeight":null,"aminoAcidEnd":146,"aminoAcidStart":95,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P35318","tags":[{"tag":"Fc","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

The adrenomedullin (ADM) protein alternatively known as protein n20 is a peptide hormone with a mass of approximately 6 kilodaltons. It is mainly expressed in the adrenal medulla but you can also find it in various tissues including the heart lungs and kidneys. ADM is involved in multiple physiological processes operating as a vasodilator and playing a role in blood pressure regulation. The presence of ADM in endothelial and smooth muscle cells emphasizes its role in vascular function.
Biological function summary

Adrenomedullin contributes to homeostasis and cellular growth. It is not a part of a complex but interacts with specific receptors like the calcitonin receptor-like receptor (CRLR) and receptor activity-modifying proteins (RAMPs). These interactions activate signaling cascades that contribute to mitogenesis and angiogenesis highlighting ADM's role in cellular protection and tissue repair. ADM's activity extends to immune modulation and fluid-electrolyte balance.

Pathways

Adrenomedullin shows involvement in signaling pathways like the cAMP and MAPK pathways. It interacts closely with proteins such as RAMP2 and RAMP3 which define its receptor heterodimers in a tissue-dependent manner. ADM influences cellular responses by promoting vasodilation and modulating inflammatory responses fitting integrally into vascular homeostasis and immune functions.

ADM relates to cardiovascular and inflammatory diseases. It shows altered expression levels in conditions such as heart failure and sepsis. In these diseases ADM interacts with molecules like endothelin-1 which affect vascular tone and endothelial function. Understanding ADM's role can lead to potential therapeutic strategies targeting its pathways in cardiovascular and inflammatory pathologies.

일반 정보

기능

Adrenomedullin/ADM and proadrenomedullin N-20 terminal peptide/PAMP are peptide hormones that act as potent hypotensive and vasodilatator agents (PubMed : 8387282, PubMed : 9620797). Numerous actions have been reported most related to the physiologic control of fluid and electrolyte homeostasis. In the kidney, ADM is diuretic and natriuretic, and both ADM and PAMP inhibit aldosterone secretion by direct adrenal actions. In pituitary gland, both peptides at physiologically relevant doses inhibit basal ACTH secretion. Both peptides appear to act in brain and pituitary gland to facilitate the loss of plasma volume, actions which complement their hypotensive effects in blood vessels.. Adrenomedullin. Peptide hormone that act as potent hypotensive and vasodilatator agents (PubMed : 8387282). ADM function is mediated by the CALCRL-RAMP2 and CALCRL-RAMP3 receptor complexes with ADM showing the highest potency for the CALCRL-RAMP2 complex (PubMed : 32296767, PubMed : 9620797).. Proadrenomedullin N-20 terminal peptide. Peptide hormone that act as potent hypotensive and vasodilatator agents by inhibiting catecholamine secretion from sympathetic nerve endings and adrenal chromaffin cells (PubMed : 10588445, PubMed : 9578982). Acts as a ligand for MRGPRX2 receptor in mast cells (PubMed : 15823563).. Proadrenomedullin 9-20 terminal peptide. Peptide hormone that act as potent hypotensive and vasodilatator agents by inhibiting catecholamine secretion from sympathetic nerve endings and adrenal chromaffin cells (PubMed : 10588445, PubMed : 9578982). Acts as a ligand for MRGPRX2 receptor in mast cells (PubMed : 15823563, PubMed : 34789875).

서열 유사성

Belongs to the adrenomedullin family.

제품 프로토콜

타겟 정보

Adrenomedullin/ADM and proadrenomedullin N-20 terminal peptide/PAMP are peptide hormones that act as potent hypotensive and vasodilatator agents (PubMed : 8387282, PubMed : 9620797). Numerous actions have been reported most related to the physiologic control of fluid and electrolyte homeostasis. In the kidney, ADM is diuretic and natriuretic, and both ADM and PAMP inhibit aldosterone secretion by direct adrenal actions. In pituitary gland, both peptides at physiologically relevant doses inhibit basal ACTH secretion. Both peptides appear to act in brain and pituitary gland to facilitate the loss of plasma volume, actions which complement their hypotensive effects in blood vessels.. Adrenomedullin. Peptide hormone that act as potent hypotensive and vasodilatator agents (PubMed : 8387282). ADM function is mediated by the CALCRL-RAMP2 and CALCRL-RAMP3 receptor complexes with ADM showing the highest potency for the CALCRL-RAMP2 complex (PubMed : 32296767, PubMed : 9620797).. Proadrenomedullin N-20 terminal peptide. Peptide hormone that act as potent hypotensive and vasodilatator agents by inhibiting catecholamine secretion from sympathetic nerve endings and adrenal chromaffin cells (PubMed : 10588445, PubMed : 9578982). Acts as a ligand for MRGPRX2 receptor in mast cells (PubMed : 15823563).. Proadrenomedullin 9-20 terminal peptide. Peptide hormone that act as potent hypotensive and vasodilatator agents by inhibiting catecholamine secretion from sympathetic nerve endings and adrenal chromaffin cells (PubMed : 10588445, PubMed : 9578982). Acts as a ligand for MRGPRX2 receptor in mast cells (PubMed : 15823563, PubMed : 34789875).
See full target information ADM

제품이 사용된 논문 (1)

Recent publications for all applications. Explore the 전체 목록 and refine your search

Acta biomaterialia 145:146-158 PubMed35381399

2022

Nanoparticles with dense poly(ethylene glycol) coatings with near neutral charge are maximally transported across lymphatics and to the lymph nodes.

Applications

Unspecified application

Species

Unspecified reactive species

Jacob McCright,Colin Skeen,Jenny Yarmovsky,Katharina Maisel
제품이 사용된 논문 모두 보기

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com