JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB165460

Recombinant Human APOBEC3D protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human APOBEC3D protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 386 aa range, expressed in Wheat germ, suitable for ELISA, WB.

대체 명칭 보기

APOBEC3DE, APOBEC3D, DNA dC->dU-editing enzyme APOBEC-3D, A3D, A3DE

1 이미지
SDS-PAGE - Recombinant Human APOBEC3D protein (GST tag N-Terminus) (AB165460)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human APOBEC3D protein (GST tag N-Terminus) (AB165460)

ab165460 on a 12.5% SDS-PAGE stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"sequence":"MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAEMCFLSWFCGNRLPANRRFQITWFVSWNPCLPCVVKVTKFLAEHPNVTLTISAARLYYYRDRDWRWVLLRLHKAGARVKIMDYEDFAYCWENFVCNEGQPFMPWYKFDDNYASLHRTLKEILRNPMEAMYPHIFYFHFKNLLKACGRNESWLCFTMEVTKHHSAVFRKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVKIMGYKDFVSCWKNFVYSDDEPFKPWKGLQTNFRLLKRRLREILQ","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":386,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q96AK3","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

APOBEC3D also known as APOBEC-related cytidine deaminase plays a role in the editing of nucleic acids by deaminating cytosine to uracil in single-stranded DNA. This protein possesses a mass of approximately 46 kDa. APOBEC3D is expressed primarily in lymphoid tissues including the spleen and lymph nodes. It belongs to a larger group of APOBEC family proteins that extend their functions to various aspects of nucleic acid metabolism.
Biological function summary

The protein modifies DNA sequences and contributes to the innate immune response which acts as a defense against viral infections. APOBEC3D participates as a component of the host's antiviral machinery generating mutations in viral genomes that can inhibit virus replication. While it does not form a stable complex akin to some of its family members such as APOBEC3G its activity associates with the presence of the APOBEC3 protein family acting coordinately in host cellular processes.

Pathways

APOBEC3D integrates into the broader mechanism of intrinsic immunity specifically targeting viral genomes for mutation. The protein also intersects with pathways connected to nucleic acid processing. Related proteins in these immunity pathways include APOBEC3G and APOBEC3F which similarly act to induce hypermutation in retroviral and other viral agents offering a collective resistance against viral propagation.

APOBEC3D has links to certain autoimmune disorders and cancer. The activity of APOBEC3D like its relatives can contribute to genome hypermutation which plays a part in cancer development and progression. APOBEC3D in combination with other members like APOBEC3B contributes to mutational signatures found in various cancer types highlighting its potential role in tumorigenesis. Studies continue to investigate its impact on HIV-1 infection reinforcing its connection with the body's defense mechanisms and potential implications in disease resistance or susceptibility.

일반 정보

기능

DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms (PubMed : 16920826, PubMed : 20062055, PubMed : 21835787). Exhibits antiviral activity against HIV-1. After the penetration of retroviral nucleocapsids into target cells of infection and the initiation of reverse transcription, it can induce the conversion of cytosine to uracil in the minus-sense single-strand viral DNA, leading to G-to-A hypermutations in the subsequent plus-strand viral DNA (PubMed : 16920826). The resultant detrimental levels of mutations in the proviral genome, along with a deamination-independent mechanism that works prior to the proviral integration, together exert efficient antiretroviral effects in infected target cells. Selectively targets single-stranded DNA and does not deaminate double-stranded DNA or single- or double-stranded RNA. Also inhibits the mobility of LTR and non-LTR retrotransposons (PubMed : 27428332).. (Microbial infection) Enhances hepatitis B virus/HBV replication by excluding restriction factors APOBEC3F and APOBEC3G from HBV capsids.

서열 유사성

Belongs to the cytidine and deoxycytidylate deaminase family.

제품 프로토콜

타겟 정보

DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms (PubMed : 16920826, PubMed : 20062055, PubMed : 21835787). Exhibits antiviral activity against HIV-1. After the penetration of retroviral nucleocapsids into target cells of infection and the initiation of reverse transcription, it can induce the conversion of cytosine to uracil in the minus-sense single-strand viral DNA, leading to G-to-A hypermutations in the subsequent plus-strand viral DNA (PubMed : 16920826). The resultant detrimental levels of mutations in the proviral genome, along with a deamination-independent mechanism that works prior to the proviral integration, together exert efficient antiretroviral effects in infected target cells. Selectively targets single-stranded DNA and does not deaminate double-stranded DNA or single- or double-stranded RNA. Also inhibits the mobility of LTR and non-LTR retrotransposons (PubMed : 27428332).. (Microbial infection) Enhances hepatitis B virus/HBV replication by excluding restriction factors APOBEC3F and APOBEC3G from HBV capsids.
See full target information APOBEC3D

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com