JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB177619

Recombinant Human Apolipoprotein CI/Apo-CI (His tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(1 출판물)

Recombinant Human Apolipoprotein CI/Apo-CI (His tag N-Terminus) is a Human Full Length protein, in the 27 to 83 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

대체 명칭 보기

Apolipoprotein C-I, Apo-CI, ApoC-I, Apolipoprotein C1, APOC1

1 이미지
SDS-PAGE - Recombinant Human Apolipoprotein CI/Apo-CI (His tag N-Terminus) (AB177619)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Apolipoprotein CI/Apo-CI (His tag N-Terminus) (AB177619)

3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.

주요 정보

Purity

>90% SDS-PAGE

ab177619 is purified by using conventional chromatography techniques.

발현 시스템

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

This product was previously labelled as Apolipoprotein CI

서열 정보

[{"linker":null,"sequence":"MGSSHHHHHHSSGLVPRGSHMGSTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS","proteinLength":"Full Length","predictedMolecularWeight":"9 kDa","actualMolecularWeight":null,"aminoAcidEnd":83,"aminoAcidStart":27,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P02654","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 기간
1-2 weeks
적절한 단기 보관 조건
+4°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Apolipoprotein CI (Apo-CI) plays a mechanical role in lipid metabolism where it acts as an inhibitor of lipoprotein lipase and hepatic lipase hindering lipolytic activity. It is also known as 'apo 250' and 'apo atv20' with a molecular mass of approximately 6.6 kDa. Apo-CI is primarily expressed in the liver and secreted into the plasma where it associates with high-density lipoproteins (HDL) and very low-density lipoproteins (VLDL).
Biological function summary

Apo-CI influences plasma triglyceride levels and cholesterol homeostasis. It plays a role in lipid transport and metabolism by modulating the binding of other apolipoproteins such as apo A-IV and interfering with the binding of lipoproteins to their receptors. Apo-CI is part of a complex of apolipoproteins that regulate lipid metabolism working in tandem to balance lipid and cholesterol levels in the body.

Pathways

Apo-CI is actively involved in the lipoprotein metabolism pathway and cholesterol efflux pathway. These pathways are important in maintaining lipid balance and cardiovascular health. Apo-CI is related to other apolipoproteins within these pathways such as apo E and apo A-I. Its function in modulating lipoprotein receptor interactions aligns with the broader mechanisms of these pathways in lipid and cholesterol regulation.

Elevated levels of Apo-CI are associated with hyperlipidemia and cardiovascular disease. These conditions may result from its inhibitory effects on lipase activity leading to increased triglyceride levels. Apo-CI's interaction with other apolipoproteins such as apo B and apo E is linked to its role in the pathogenesis of these disorders. Understanding Apo-CI's involvement in these diseases can guide therapeutic strategies aimed at regulating its expression and function.

일반 정보

기능

Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.

서열 유사성

Belongs to the apolipoprotein C1 family.

제품 프로토콜

타겟 정보

Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.
See full target information APOC1

제품이 사용된 논문 (1)

Recent publications for all applications. Explore the 전체 목록 and refine your search

iScience 24:103538 PubMed34917906

2021

CD95/Fas suppresses NF-κB activation through recruitment of KPC2 in a CD95L/FasL-independent mechanism.

Applications

Unspecified application

Species

Unspecified reactive species

Jean-Philippe Guégan,Justine Pollet,Christophe Ginestier,Emmanuelle Charafe-Jauffret,Marcus E Peter,Patrick Legembre
제품이 사용된 논문 모두 보기

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com