JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB123766

Recombinant Human Apolipoprotein E4

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Apolipoprotein E4 is a Human Full Length protein, in the 19 to 317 aa range, expressed in Escherichia coli, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC.

대체 명칭 보기

Apolipoprotein E, Apo-E, APOE

1 이미지
SDS-PAGE - Recombinant Human Apolipoprotein E4 (AB123766)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Apolipoprotein E4 (AB123766)

SDS-PAGE analysis of reduced ab123766. The purity of the protein is greater than 95%. Lane 1 : 0.5 µg Lane 2 : 1 µg Lane 3 : 2 µg

주요 정보

Purity

>90% SDS-PAGE

Purity is greater than 90% as determined by HPLC and SDS-PAGE. Endotoxin level is <0.1 ng per µg of Apolipoprotein E4.

Endotoxin 레벨

< 1 EU/µg

발현 시스템

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, HPLC

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in water

보관 버퍼

pH: 7.4 Constituents: 10.269% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

This product is manufactured by BioVision, an Abcam company and was previously called 4699 ApoE4, human recombinant. 4699-100 is the same size as the 100 μg size of ab123766.

서열 정보

[{"linker":null,"sequence":"MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH","proteinLength":"Full Length","predictedMolecularWeight":"34.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":317,"aminoAcidStart":19,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P02649","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
보관 정보
Store under desiccating conditions
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Apolipoprotein E4 often called ApoE4 is a member of the apolipoprotein family and plays an important role in lipid metabolism. As a 34-kDa protein it associates with lipoprotein particles and mediates receptor binding and clearance of these complexes. ApoE4 expresses mainly in the liver and the brain where it facilitates cholesterol and lipid transport and homeostasis. Other important alternative names for this protein include apo E4 and E4 peptide which identify specific functions related to its diverse roles in the body.
Biological function summary

ApoE4 is an important player in lipid transport and uptake facilitating the redistribution of lipids among cells. It forms part of a critical complex involved in binding to low-density lipoprotein receptors (LDLR) and the related protein family enabling efficient lipid delivery to peripheral tissues. The interaction of ApoE4 with these receptors directly influences cellular lipid balance impacting important cellular functions. Additionally its polymorphic nature allows the isoforms E2 E3 and E4 to differ in their impacts on lipid transport and disease risk.

Pathways

ApoE4 engages in the lipid and cholesterol transport pathways prominently impacting the reverse cholesterol transport process and the regulation of plasma lipoprotein metabolism. It interacts with proteins such as LDLR and LRP1 influencing the removal of triglyceride-rich lipoproteins and modulating lipid levels in the circulation. ApoE4's involvement in these pathways highlights its role as a central regulator of lipid homeostasis.

ApoE4 is closely associated with Alzheimer’s disease and cardiovascular disease highlighting its significance beyond lipid transport. ApoE4's isoform uniquely elevates the risk for Alzheimer's disease by potentially altering amyloid-beta metabolism and interfering with tau-associated pathologies making it a target of interest in neurodegenerative research. Additionally individuals bearing the ApoE4 allele exhibit an increased susceptibility to cardiovascular disorders due to its impact on cholesterol transport and clearance often linking it with elevated blood cholesterol levels. Through these diseases ApoE4 connects with other proteins like amyloid precursor protein (APP) and tau in Alzheimer's disease illustrating the broader implications of its biological functions.

일반 정보

기능

APOE is an apolipoprotein, a protein associating with lipid particles, that mainly functions in lipoprotein-mediated lipid transport between organs via the plasma and interstitial fluids (PubMed : 14754908, PubMed : 1911868, PubMed : 6860692). APOE is a core component of plasma lipoproteins and is involved in their production, conversion and clearance (PubMed : 14754908, PubMed : 1911868, PubMed : 1917954, PubMed : 23620513, PubMed : 2762297, PubMed : 6860692, PubMed : 9395455). Apolipoproteins are amphipathic molecules that interact both with lipids of the lipoprotein particle core and the aqueous environment of the plasma (PubMed : 2762297, PubMed : 6860692, PubMed : 9395455). As such, APOE associates with chylomicrons, chylomicron remnants, very low density lipoproteins (VLDL) and intermediate density lipoproteins (IDL) but shows a preferential binding to high-density lipoproteins (HDL) (PubMed : 1911868, PubMed : 6860692). It also binds a wide range of cellular receptors including the LDL receptor/LDLR, the LDL receptor-related proteins LRP1, LRP2 and LRP8 and the very low-density lipoprotein receptor/VLDLR that mediate the cellular uptake of the APOE-containing lipoprotein particles (PubMed : 12950167, PubMed : 1530612, PubMed : 1917954, PubMed : 20030366, PubMed : 20303980, PubMed : 2063194, PubMed : 2762297, PubMed : 7635945, PubMed : 7768901, PubMed : 8756331, PubMed : 8939961). Finally, APOE also has a heparin-binding activity and binds heparan-sulfate proteoglycans on the surface of cells, a property that supports the capture and the receptor-mediated uptake of APOE-containing lipoproteins by cells (PubMed : 23676495, PubMed : 7635945, PubMed : 9395455, PubMed : 9488694). A main function of APOE is to mediate lipoprotein clearance through the uptake of chylomicrons, VLDLs, and HDLs by hepatocytes (PubMed : 1911868, PubMed : 1917954, PubMed : 23676495, PubMed : 29516132, PubMed : 9395455). APOE is also involved in the biosynthesis by the liver of VLDLs as well as their uptake by peripheral tissues ensuring the delivery of triglycerides and energy storage in muscle, heart and adipose tissues (PubMed : 2762297, PubMed : 29516132). By participating in the lipoprotein-mediated distribution of lipids among tissues, APOE plays a critical role in plasma and tissues lipid homeostasis (PubMed : 1917954, PubMed : 2762297, PubMed : 29516132). APOE is also involved in two steps of reverse cholesterol transport, the HDLs-mediated transport of cholesterol from peripheral tissues to the liver, and thereby plays an important role in cholesterol homeostasis (PubMed : 14754908, PubMed : 23620513, PubMed : 9395455). First, it is functionally associated with ABCA1 in the biogenesis of HDLs in tissues (PubMed : 14754908, PubMed : 23620513). Second, it is enriched in circulating HDLs and mediates their uptake by hepatocytes (PubMed : 9395455). APOE also plays an important role in lipid transport in the central nervous system, regulating neuron survival and sprouting (PubMed : 25173806, PubMed : 8939961). APOE is also involved in innate and adaptive immune responses, controlling for instance the survival of myeloid-derived suppressor cells (By similarity). Binds to the immune cell receptor LILRB4 (PubMed : 30333625). APOE may also play a role in transcription regulation through a receptor-dependent and cholesterol-independent mechanism, that activates MAP3K12 and a non-canonical MAPK signal transduction pathway that results in enhanced AP-1-mediated transcription of APP (PubMed : 28111074).. (Microbial infection) Through its interaction with HCV envelope glycoprotein E2, participates in the attachment of HCV to HSPGs and other receptors (LDLr, VLDLr, and SR-B1) on the cell surface and to the assembly, maturation and infectivity of HCV viral particles (PubMed : 25122793, PubMed : 29695434). This interaction is probably promoted via the up-regulation of cellular autophagy by the virus (PubMed : 29695434).

서열 유사성

Belongs to the apolipoprotein A1/A4/E family.

Post-translational modifications

APOE exists as multiple glycosylated and sialylated glycoforms within cells and in plasma (PubMed:29516132). The extent of glycosylation and sialylation are tissue and context specific (PubMed:29516132). Plasma APOE undergoes desialylation and is less glycosylated and sialylated than the cellular form (PubMed:19838169, PubMed:20511397, PubMed:23234360, PubMed:2498325). Glycosylation is not required for proper expression and secretion (PubMed:2498325). O-glycosylated with core 1 or possibly core 8 glycans. Thr-307 and Ser-314 are minor glycosylation sites compared to Ser-308 (PubMed:19838169, PubMed:23234360).. Glycated in plasma VLDL of normal subjects, and of hyperglycemic diabetic patients at a higher level (2-3 fold).. Phosphorylated by FAM20C in the extracellular medium.. Undergoes C-terminal proteolytic processing in neurons. C-terminally truncated APOE has a tendency to form neurotoxic intracellular neurofibrillary tangle-like inclusions in neurons.

Subcellular localisation

Endosome

제품 프로토콜

타겟 정보

APOE is an apolipoprotein, a protein associating with lipid particles, that mainly functions in lipoprotein-mediated lipid transport between organs via the plasma and interstitial fluids (PubMed : 14754908, PubMed : 1911868, PubMed : 6860692). APOE is a core component of plasma lipoproteins and is involved in their production, conversion and clearance (PubMed : 14754908, PubMed : 1911868, PubMed : 1917954, PubMed : 23620513, PubMed : 2762297, PubMed : 6860692, PubMed : 9395455). Apolipoproteins are amphipathic molecules that interact both with lipids of the lipoprotein particle core and the aqueous environment of the plasma (PubMed : 2762297, PubMed : 6860692, PubMed : 9395455). As such, APOE associates with chylomicrons, chylomicron remnants, very low density lipoproteins (VLDL) and intermediate density lipoproteins (IDL) but shows a preferential binding to high-density lipoproteins (HDL) (PubMed : 1911868, PubMed : 6860692). It also binds a wide range of cellular receptors including the LDL receptor/LDLR, the LDL receptor-related proteins LRP1, LRP2 and LRP8 and the very low-density lipoprotein receptor/VLDLR that mediate the cellular uptake of the APOE-containing lipoprotein particles (PubMed : 12950167, PubMed : 1530612, PubMed : 1917954, PubMed : 20030366, PubMed : 20303980, PubMed : 2063194, PubMed : 2762297, PubMed : 7635945, PubMed : 7768901, PubMed : 8756331, PubMed : 8939961). Finally, APOE also has a heparin-binding activity and binds heparan-sulfate proteoglycans on the surface of cells, a property that supports the capture and the receptor-mediated uptake of APOE-containing lipoproteins by cells (PubMed : 23676495, PubMed : 7635945, PubMed : 9395455, PubMed : 9488694). A main function of APOE is to mediate lipoprotein clearance through the uptake of chylomicrons, VLDLs, and HDLs by hepatocytes (PubMed : 1911868, PubMed : 1917954, PubMed : 23676495, PubMed : 29516132, PubMed : 9395455). APOE is also involved in the biosynthesis by the liver of VLDLs as well as their uptake by peripheral tissues ensuring the delivery of triglycerides and energy storage in muscle, heart and adipose tissues (PubMed : 2762297, PubMed : 29516132). By participating in the lipoprotein-mediated distribution of lipids among tissues, APOE plays a critical role in plasma and tissues lipid homeostasis (PubMed : 1917954, PubMed : 2762297, PubMed : 29516132). APOE is also involved in two steps of reverse cholesterol transport, the HDLs-mediated transport of cholesterol from peripheral tissues to the liver, and thereby plays an important role in cholesterol homeostasis (PubMed : 14754908, PubMed : 23620513, PubMed : 9395455). First, it is functionally associated with ABCA1 in the biogenesis of HDLs in tissues (PubMed : 14754908, PubMed : 23620513). Second, it is enriched in circulating HDLs and mediates their uptake by hepatocytes (PubMed : 9395455). APOE also plays an important role in lipid transport in the central nervous system, regulating neuron survival and sprouting (PubMed : 25173806, PubMed : 8939961). APOE is also involved in innate and adaptive immune responses, controlling for instance the survival of myeloid-derived suppressor cells (By similarity). Binds to the immune cell receptor LILRB4 (PubMed : 30333625). APOE may also play a role in transcription regulation through a receptor-dependent and cholesterol-independent mechanism, that activates MAP3K12 and a non-canonical MAPK signal transduction pathway that results in enhanced AP-1-mediated transcription of APP (PubMed : 28111074).. (Microbial infection) Through its interaction with HCV envelope glycoprotein E2, participates in the attachment of HCV to HSPGs and other receptors (LDLr, VLDLr, and SR-B1) on the cell surface and to the assembly, maturation and infectivity of HCV viral particles (PubMed : 25122793, PubMed : 29695434). This interaction is probably promoted via the up-regulation of cellular autophagy by the virus (PubMed : 29695434).
See full target information APOE

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com