JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114948

Recombinant Human ASAH1 protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human ASAH1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 25 to 124 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

ASAH, HSD-33, HSD33, ASAH1, Acid ceramidase, AC, ACDase, Acid CDase, Acylsphingosine deacylase, Glycosylceramide deacylase, N-acylethanolamine hydrolase ASAH1, N-acylsphingosine amidohydrolase, Putative 32 kDa heart protein, PHP32

1 이미지
SDS-PAGE - Recombinant Human ASAH1 protein (GST tag N-Terminus) (AB114948)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ASAH1 protein (GST tag N-Terminus) (AB114948)

12.5% SDS-PAGE showing ab114948 at approximately 36.63kDa.
Stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, WB, ELISA

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>Recombinant protein.</p>" } } }

제품 세부 정보

Protein concentration is above or equal to 0.05 mg/ml.
Best used within three months from the date of receipt.

서열 정보

[{"linker":null,"sequence":"PPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPMLKVIVNSLKNMINTFVPSGKVMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTD","proteinLength":"Fragment","predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":124,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q13510","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

ASAH1 also known as acid ceramidase or alkaline ceramidase is an enzyme that plays a role in the hydrolysis of ceramides into sphingosine and free fatty acids. It has a mass of approximately 55 kDa. This enzyme is primarily found in lysosomes cellular organelles that manage waste. ASAH1 is expressed in various tissues including liver heart brain and skin illustrating its widespread distribution in the body.
Biological function summary

ASAH1 influences several important cellular processes by controlling the levels of ceramide and sphingosine. These lipids are not just structural components of membranes; they participate actively in cell signaling. ASAH1 exists as part of a larger complex that includes other enzymes involved in sphingolipid metabolism. Changes in ceramide levels influence apoptosis and cell proliferation indicating ASAH1's role as a regulator in these processes.

Pathways

ASAH1 is central to the sphingolipid metabolism pathway. This pathway is interconnected with the apoptosis signaling pathway. By converting ceramide to sphingosine ASAH1 links the complex ceramide/sphingosine balance affecting cell survival and death decisions. It interacts with other enzymes such as sphingosine kinase 1 and ceramide synthases which further maintain the dynamic regulation between sphingosine and ceramide levels.

ASAH1 is linked to conditions such as Farber disease and spinal muscular atrophy. These disorders result from dysfunctional ceramide metabolism causing cellular and systemic impacts due to excessive ceramide accumulation. Proteins like acid sphingomyelinase are related to ASAH1's role in these diseases as both contribute to sphingolipid balance in cells. Understanding ASAH1 and its pathways provides insights into potential therapeutic targets for these sphingolipid-related disorders.

일반 정보

기능

Lysosomal ceramidase that hydrolyzes sphingolipid ceramides into sphingosine and free fatty acids at acidic pH (PubMed : 10610716, PubMed : 11451951, PubMed : 15655246, PubMed : 26898341, PubMed : 36752535, PubMed : 7744740, PubMed : 7852294). Ceramides, sphingosine, and its phosphorylated form sphingosine-1-phosphate are bioactive lipids that mediate cellular signaling pathways regulating several biological processes including cell proliferation, apoptosis and differentiation (PubMed : 10610716). Has a higher catalytic efficiency towards C12-ceramides versus other ceramides (PubMed : 15655246, PubMed : 7744740). Also catalyzes the reverse reaction allowing the synthesis of ceramides from fatty acids and sphingosine (PubMed : 12764132, PubMed : 12815059). For the reverse synthetic reaction, the natural sphingosine D-erythro isomer is more efficiently utilized as a substrate compared to D-erythro-dihydrosphingosine and D-erythro-phytosphingosine, while the fatty acids with chain lengths of 12 or 14 carbons are the most efficiently used (PubMed : 12764132). Also has an N-acylethanolamine hydrolase activity (PubMed : 15655246). By regulating the levels of ceramides, sphingosine and sphingosine-1-phosphate in the epidermis, mediates the calcium-induced differentiation of epidermal keratinocytes (PubMed : 17713573). Also indirectly regulates tumor necrosis factor/TNF-induced apoptosis (By similarity). By regulating the intracellular balance between ceramides and sphingosine, in adrenocortical cells, probably also acts as a regulator of steroidogenesis (PubMed : 22261821).. Isoform 2. May directly regulate steroidogenesis by binding the nuclear receptor NR5A1 and negatively regulating its transcriptional activity.

서열 유사성

Belongs to the acid ceramidase family.

Post-translational modifications

N-glycosylated.. Proteolytically cleaved into two chains alpha and beta that remain associated via a disulfide bond (PubMed:11451951, PubMed:29692406, PubMed:30525581, PubMed:7744740). Cleavage gives rise to a conformation change that activates the enzyme. The same catalytic Cys residue mediates the autoproteolytic cleavage and subsequent hydrolysis of lipid substrates (PubMed:29692406, PubMed:30525581). The beta chain may undergo an additional C-terminal processing (PubMed:12815059).

제품 프로토콜

타겟 정보

Lysosomal ceramidase that hydrolyzes sphingolipid ceramides into sphingosine and free fatty acids at acidic pH (PubMed : 10610716, PubMed : 11451951, PubMed : 15655246, PubMed : 26898341, PubMed : 36752535, PubMed : 7744740, PubMed : 7852294). Ceramides, sphingosine, and its phosphorylated form sphingosine-1-phosphate are bioactive lipids that mediate cellular signaling pathways regulating several biological processes including cell proliferation, apoptosis and differentiation (PubMed : 10610716). Has a higher catalytic efficiency towards C12-ceramides versus other ceramides (PubMed : 15655246, PubMed : 7744740). Also catalyzes the reverse reaction allowing the synthesis of ceramides from fatty acids and sphingosine (PubMed : 12764132, PubMed : 12815059). For the reverse synthetic reaction, the natural sphingosine D-erythro isomer is more efficiently utilized as a substrate compared to D-erythro-dihydrosphingosine and D-erythro-phytosphingosine, while the fatty acids with chain lengths of 12 or 14 carbons are the most efficiently used (PubMed : 12764132). Also has an N-acylethanolamine hydrolase activity (PubMed : 15655246). By regulating the levels of ceramides, sphingosine and sphingosine-1-phosphate in the epidermis, mediates the calcium-induced differentiation of epidermal keratinocytes (PubMed : 17713573). Also indirectly regulates tumor necrosis factor/TNF-induced apoptosis (By similarity). By regulating the intracellular balance between ceramides and sphingosine, in adrenocortical cells, probably also acts as a regulator of steroidogenesis (PubMed : 22261821).. Isoform 2. May directly regulate steroidogenesis by binding the nuclear receptor NR5A1 and negatively regulating its transcriptional activity.
See full target information ASAH1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com