JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB160342

Recombinant Human ATP6V0D1/P39 protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human ATP6V0D1/P39 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 351 aa range, expressed in Wheat germ, suitable for ELISA, WB.

대체 명칭 보기

ATP6D, VPATPD, ATP6V0D1, V-type proton ATPase subunit d 1, V-ATPase subunit d 1, 32 kDa accessory protein, V-ATPase 40 kDa accessory protein, V-ATPase AC39 subunit, Vacuolar proton pump subunit d 1, p39

1 이미지
SDS-PAGE - Recombinant Human ATP6V0D1/P39 protein (GST tag N-Terminus) (AB160342)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ATP6V0D1/P39 protein (GST tag N-Terminus) (AB160342)

ab160342 on a 12.5% SDS-PAGE stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

This product was previously labelled as ATP6V0D1.

서열 정보

[{"linker":null,"sequence":"MSFFPEHYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":351,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P61421","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

ATP6V0D1 also known as P39 is a subunit of the V0 domain of the vacuolar ATPase (V-ATPase) complex. This protein has an approximate mass of 39 kDa. ATP6V0D1 is broadly expressed in various tissues with higher levels in metabolically active cells such as kidney and liver cells. The V-ATPase complex is essential for acidifying intracellular compartments which aids in numerous cellular processes including protein degradation and receptor-mediated endocytosis.
Biological function summary

ATP6V0D1 impacts the acidification necessary for intracellular processes by being a component of the V-ATPase complex. This complex functions as a proton pump moving protons across membranes to regulate pH in cellular compartments like lysosomes and endosomes. Proper function of V-ATPase and thereby of ATP6V0D1 is important for cellular homeostasis and energy metabolism. Disruption of these processes could impair critical functions such as protein degradation and nutrient processing.

Pathways

ATP6V0D1 plays roles in key cellular pathways such as the glucose metabolism pathway and protein processing in the endoplasmic reticulum. In these pathways ATP6V0D1 works closely with other proteins like ATP6V1 subunits within the V-ATPase complex. Its involvement in these pathways highlights not only its importance in cellular energy balance but also in maintaining the structural integrity of cells under varying metabolic conditions.

ATP6V0D1 is linked to conditions such as osteopetrosis and renal tubular acidosis. These disorders relate to the malfunction of acidification in cells where ATP6V0D1 expression is important highlighting the connection between disrupted ATP6V0D1 function and impaired cellular processes. Proteins like ATP6V0A1 another subunit of the V-ATPase complex also play a role in these conditions emphasizing the need for functional cooperation among these proteins to maintain normal physiological states.

일반 정보

기능

Subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons (PubMed : 28296633, PubMed : 30374053, PubMed : 33065002). V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment (PubMed : 30374053). May play a role in coupling of proton transport and ATP hydrolysis (By similarity). In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation (PubMed : 28296633). May play a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium (By similarity).

서열 유사성

Belongs to the V-ATPase V0D/AC39 subunit family.

Subcellular localisation

Lysosome membrane

제품 프로토콜

타겟 정보

Subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons (PubMed : 28296633, PubMed : 30374053, PubMed : 33065002). V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment (PubMed : 30374053). May play a role in coupling of proton transport and ATP hydrolysis (By similarity). In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation (PubMed : 28296633). May play a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium (By similarity).
See full target information ATP6V0D1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com