JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB199588

Recombinant Human C4 protein

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human C4 protein is a Human Full Length protein, in the 1454 to 1744 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

대체 명칭 보기

CO4, CPAMD2, C4A, Complement C4-A, Acidic complement C4, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2

주요 정보

Purity

>90% SDS-PAGE

The final product was refolded using unique “temperature shift inclusion body refolding” technology and chromatographically purified.

발현 시스템

Escherichia coli

Tags

T7 tag N-Terminus His tag N-Terminus TEV tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.32% Tris HCl

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MASMTGGQQMGRGHHHHHHGNLYFQGGEFEAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV","proteinLength":"Full Length","predictedMolecularWeight":"36.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":1744,"aminoAcidStart":1454,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P0C0L4","tags":[{"tag":"T7","terminus":"N-Terminus"},{"tag":"His","terminus":"N-Terminus"},{"tag":"TEV","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Complement component 4 (C4) is a significant protein in the complement system also known as C4 complement. C4 has a molecular mass of approximately 206 kDa and mainly expresses in the liver. It is present in the blood plasma. C4 plays an important role in the immunological response and activates classical and lectin complement pathways. It serves a mechanical function by binding to pathogen surfaces and facilitating the cleavage that leads to the downstream activation of the complement cascade. There's a C4 ELISA test that allows for quantifying C4 levels in serum which is important for clinical diagnostics.
Biological function summary

Complement C4 participates in the immune defense by marking pathogens for destruction and enhancing phagocytosis. C4 is a part of a complex with other complement proteins like C3 and C1 to initiate the formation of the C3 convertase enzyme. This action amplifies the immune response leading to the clearance of microorganisms and apoptotic cells. C4 also plays a role in regulating the inflammation process maintaining homeostasis in the immune system.

Pathways

C4 fits into the complement activation pathway specifically the classical and lectin pathways. These pathways are important for innate immunity and connect with components like complement C3 and complement C1. Through the classical pathway C4 gets activated after binding to antibodies that have recognized antigens leading to a chain reaction that strengthens the immune response. The lectin pathway also requires C4 activation through different stimuli solidifying C4's central role in immune system signaling networks.

Abnormal C4 activity associates with autoimmune diseases like systemic lupus erythematosus (SLE) and rheumatoid arthritis. Low levels of complement C4 in serum can indicate these autoimmune conditions where the immune system mistakenly attacks its own tissues. C4 also connects to other proteins like complement component C1q in the context of SLE. C4 deficiencies or abnormalities may contribute to the development or exacerbation of these diseases highlighting its importance in disease pathogenesis and highlighting its value as a target for diagnostic tests such as C4 ELISA or serum complement tests.

일반 정보

기능

Precursor of non-enzymatic components of the classical, lectin and GZMK complement pathways, which consist in a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system.. Complement C4b-A. Non-enzymatic component of C3 and C5 convertases (PubMed : 8538770). Generated following cleavage by complement proteases (C1S, MASP2 or GZMK, depending on the complement pathway), it covalently attaches to the surface of pathogens, where it acts as an opsonin that marks the surface of antigens for removal (PubMed : 27738201, PubMed : 8538770). It then recruits the serine protease complement C2b to form the C3 and C5 convertases, which cleave and activate C3 and C5, respectively, the next components of the complement pathways (PubMed : 12878586, PubMed : 18204047, PubMed : 2387864, PubMed : 6906228). Complement C4b-A isotype is responsible for effective binding to form amide bonds with immune aggregates or protein antigens, while complement C4b-B isotype catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens (PubMed : 8538770).. C4a anaphylatoxin. Putative humoral mediator released following cleavage by complement proteases (C1S, MASP2 or GZMK, depending on the complement pathway) (PubMed : 6167582). While it is strongly similar to anaphylatoxins, its role is unclear (PubMed : 25659340). Was reported to act as a mediator of local inflammatory process; however these effects were probably due to contamination with C3a and/C5a anaphylatoxins in biological assays (PubMed : 25659340).

Post-translational modifications

Prior to secretion, the single-chain precursor is enzymatically cleaved by plasminogen (PLG) to yield non-identical chains alpha, beta and gamma (PubMed:76991). During activation of the complement systems, the alpha chain is cleaved into C4a and C4b by different proteases depending on the complement pathway: C4b stays linked to the beta and gamma chains, while C4a is released in the plasma (PubMed:11527969, PubMed:16169853, PubMed:22949645, PubMed:467643, PubMed:6319179, PubMed:9422791). The alpha chain is cleaved by C1S to generate C4a and C4b following activation by the classical complement system (PubMed:11527969, PubMed:16169853, PubMed:22949645, PubMed:467643, PubMed:6319179, PubMed:9422791). The alpha chain is cleaved to generate C4a and C4b by MASP2 following activation by the lectin complement system (PubMed:11527969, PubMed:22691502, PubMed:22949645). The alpha chain is cleaved by GZMK to generate C4a and C4b following activation by the GZMK complement system (PubMed:39914456, PubMed:39814882). Further degradation of C4b by C1 into the inactive fragments C4c and C4d blocks the generation of C3 convertase (PubMed:3696167). The proteolytic cleavages often are incomplete so that many structural forms can be found in plasma (PubMed:3696167).. Complement C4b-A. Upon activation, the internal thioester bond reacts with carbohydrate antigens on the target surface to form amide or ester bonds, leading to covalent association with the surface of pathogens.. Complement C4b-A. Ser-1236 of complement C4b interacts with complement C3b via a thioester linkage.. N- and O-glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan.

제품 프로토콜

타겟 정보

Precursor of non-enzymatic components of the classical, lectin and GZMK complement pathways, which consist in a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system.. Complement C4b-A. Non-enzymatic component of C3 and C5 convertases (PubMed : 8538770). Generated following cleavage by complement proteases (C1S, MASP2 or GZMK, depending on the complement pathway), it covalently attaches to the surface of pathogens, where it acts as an opsonin that marks the surface of antigens for removal (PubMed : 27738201, PubMed : 8538770). It then recruits the serine protease complement C2b to form the C3 and C5 convertases, which cleave and activate C3 and C5, respectively, the next components of the complement pathways (PubMed : 12878586, PubMed : 18204047, PubMed : 2387864, PubMed : 6906228). Complement C4b-A isotype is responsible for effective binding to form amide bonds with immune aggregates or protein antigens, while complement C4b-B isotype catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens (PubMed : 8538770).. C4a anaphylatoxin. Putative humoral mediator released following cleavage by complement proteases (C1S, MASP2 or GZMK, depending on the complement pathway) (PubMed : 6167582). While it is strongly similar to anaphylatoxins, its role is unclear (PubMed : 25659340). Was reported to act as a mediator of local inflammatory process; however these effects were probably due to contamination with C3a and/C5a anaphylatoxins in biological assays (PubMed : 25659340).
See full target information C4A

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com