JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB236195

Recombinant Human C4b protein (Tagged)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human C4b protein (Tagged) is a Human Fragment protein, in the 1454 to 1744 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

대체 명칭 보기

CO4, CPAMD3, C4B_2, C4B, Complement C4-B, Basic complement C4, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3

1 이미지
SDS-PAGE - Recombinant Human C4b protein (Tagged) (AB236195)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human C4b protein (Tagged) (AB236195)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel using ab236195.

주요 정보

Purity

>90% SDS-PAGE

발현 시스템

Escherichia coli

Tags

6x His tag N-Terminus SUMO tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"EAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV","proteinLength":"Fragment","predictedMolecularWeight":"49.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":1744,"aminoAcidStart":1454,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P0C0L5","tags":[{"tag":"6x His","terminus":"N-Terminus"},{"tag":"SUMO","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

The 'C4b' protein also known as the 'C4b complement' plays a significant role in the immune system. This protein is a part of the larger complement system specifically as a segment derived from the cleavage of the native 'C4 complement'. It has an estimated molecular mass of about 200 kDa. The 'C4b' protein is prominently expressed on the surface of cells and in body fluids where the immune response is active. As an important player in the complement pathway it binds covalently to foreign particles labeling them for destruction or removal by immune cells.
Biological function summary

The 'C4b complement' interacts with various other components of the immune system. It is particularly involved in the formation of the C3 and C5 convertase complexes which are essential for the opsonization and activation cascade leading to pathogen elimination. Its attachment to cellular surfaces provides a docking point for proteins such as C2 facilitating the further cleavage and progression of the complement cascade. This interaction is critical for driving the classical and lectin pathways of complement activation.

Pathways

The 'C4b protein' is integral to the classical pathway of complement activation as well as to the lectin pathway. It associates with proteins like C1s C1q and factor B forming complexes that execute various stages of immune defenses. By forming C3 and C5 convertase 'C4b' not only promotes phagocytosis but also inflammation and cell lysis through membrane attack complexes. These processes underlie the body's ability to address microbial invasions efficiently.

'C4b complement dysregulation' can lead to autoimmune conditions such as systemic lupus erythematosus (SLE) and type 1 diabetes. In SLE reduced or malfunctional 'C4b' increases susceptibility to infections and triggers inappropriate immune responses. It can also correlate with the deficiency of related proteins like C2 which further impairs the complement system. These associations indicate that proper regulation of 'C4b' is essential for maintaining immune system stability and preventing overactive immune responses.

일반 정보

기능

Precursor of non-enzymatic components of the classical, lectin and GZMK complement pathways, which consist in a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system.. Complement C4b-B. Non-enzymatic component of C3 and C5 convertases (By similarity). Generated following cleavage by complement proteases (C1S, MASP2 or GZMK, depending on the complement pathway), it covalently attaches to the surface of pathogens, where it acts as an opsonin that marks the surface of antigens for removal (By similarity). It then recruits the serine protease complement C2b to form the C3 and C5 convertases, which cleave and activate C3 and C5, respectively, the next components of the complement pathways (PubMed : 8538770). Complement C4b-B isotype catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens, while C4b-A isotype is responsible for effective binding to form amide bonds with immune aggregates or protein antigens (PubMed : 8538770).. C4a anaphylatoxin. Putative humoral mediator released following cleavage by complement proteases (C1S, MASP2 or GZMK, depending on the complement pathway). While it is strongly similar to anaphylatoxins, its role is unclear. Was reported to act as a mediator of local inflammatory process; however these effects were probably due to contamination with C3a and/C5a anaphylatoxins in biological assays.

Post-translational modifications

Prior to secretion, the single-chain precursor is enzymatically cleaved by plasminogen (PLG) to yield non-identical chains alpha, beta and gamma (By similarity). During activation of the complement systems, the alpha chain is cleaved into C4a and C4b by different proteases depending on the complement pathway: C4b stays linked to the beta and gamma chains, while C4a is released in the plasma (By similarity). The alpha chain is cleaved by C1S to generate C4a and C4b following activation by the classical complement system (By similarity). The alpha chain is cleaved to generate C4a and C4b by MASP2 following activation by the lectin complement system (By similarity). The alpha chain is cleaved by GZMK to generate C4a and C4b following activation by the GZMK complement system (By similarity). Further degradation of C4b by C1 into the inactive fragments C4c and C4d blocks the generation of C3 convertase (By similarity). The proteolytic cleavages often are incomplete so that many structural forms can be found in plasma (By similarity).. Complement C4b-B. Upon activation, the internal thioester bond reacts with carbohydrate antigens on the target surface to form amide or ester bonds, leading to covalent association with the surface of pathogens.. Complement C4b-B. Complement C4b interacts with complement C3b via a thioester linkage.. N- and O-glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan.

제품 프로토콜

타겟 정보

Precursor of non-enzymatic components of the classical, lectin and GZMK complement pathways, which consist in a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system.. Complement C4b-B. Non-enzymatic component of C3 and C5 convertases (By similarity). Generated following cleavage by complement proteases (C1S, MASP2 or GZMK, depending on the complement pathway), it covalently attaches to the surface of pathogens, where it acts as an opsonin that marks the surface of antigens for removal (By similarity). It then recruits the serine protease complement C2b to form the C3 and C5 convertases, which cleave and activate C3 and C5, respectively, the next components of the complement pathways (PubMed : 8538770). Complement C4b-B isotype catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens, while C4b-A isotype is responsible for effective binding to form amide bonds with immune aggregates or protein antigens (PubMed : 8538770).. C4a anaphylatoxin. Putative humoral mediator released following cleavage by complement proteases (C1S, MASP2 or GZMK, depending on the complement pathway). While it is strongly similar to anaphylatoxins, its role is unclear. Was reported to act as a mediator of local inflammatory process; however these effects were probably due to contamination with C3a and/C5a anaphylatoxins in biological assays.
See full target information C4B

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com