JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB241237

Recombinant Human Caspase-1 protein (Tagged)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Caspase-1 protein (Tagged) is a Human Fragment protein, in the 120 to 269 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

대체 명칭 보기

IL1BC, IL1BCE, CASP1, Caspase-1, CASP-1, Interleukin-1 beta convertase, Interleukin-1 beta-converting enzyme, p45, IL-1BC, ICE, IL-1 beta-converting enzyme

1 이미지
SDS-PAGE - Recombinant Human Caspase-1 protein (Tagged) (AB241237)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Caspase-1 protein (Tagged) (AB241237)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab241237.

주요 정보

Purity

>90% SDS-PAGE

발현 시스템

Escherichia coli

Tags

GST tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN","proteinLength":"Fragment","predictedMolecularWeight":"43.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":269,"aminoAcidStart":120,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P29466","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
보관 정보
Avoid freeze / thaw cycle
False

일반 정보

기능

Thiol protease involved in a variety of inflammatory processes by proteolytically cleaving other proteins, such as the precursors of the inflammatory cytokines interleukin-1 beta (IL1B) and interleukin 18 (IL18) as well as the pyroptosis inducer Gasdermin-D (GSDMD), into active mature peptides (PubMed : 15326478, PubMed : 15498465, PubMed : 1574116, PubMed : 26375003, PubMed : 32051255, PubMed : 37993714, PubMed : 7876192, PubMed : 9334240). Plays a key role in cell immunity as an inflammatory response initiator : once activated through formation of an inflammasome complex, it initiates a pro-inflammatory response through the cleavage of the two inflammatory cytokines IL1B and IL18, releasing the mature cytokines which are involved in a variety of inflammatory processes (PubMed : 15326478, PubMed : 15498465, PubMed : 1574116, PubMed : 32051255, PubMed : 7876192). Cleaves a tetrapeptide after an Asp residue at position P1 (PubMed : 15498465, PubMed : 1574116, PubMed : 7876192). Also initiates pyroptosis, a programmed lytic cell death pathway, through cleavage of GSDMD (PubMed : 26375003). In contrast to cleavage of interleukin IL1B, recognition and cleavage of GSDMD is not strictly dependent on the consensus cleavage site but depends on an exosite interface on CASP1 that recognizes and binds the Gasdermin-D, C-terminal (GSDMD-CT) part (PubMed : 32051255, PubMed : 32109412, PubMed : 32553275). Cleaves and activates CASP7 in response to bacterial infection, promoting plasma membrane repair (PubMed : 22464733). Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive (PubMed : 28314590). In apoptotic cells, cleaves SPHK2 which is released from cells and remains enzymatically active extracellularly (PubMed : 20197547).. Isoform Delta. Apoptosis inactive.. Isoform Epsilon. Apoptosis inactive.

서열 유사성

Belongs to the peptidase C14A family.

Post-translational modifications

The two subunits are derived from the precursor sequence by an autocatalytic mechanism.. Ubiquitinated via 'Lys-11'-linked polyubiquitination. Deubiquitinated by USP8.. Cleavage in the interdomain linker region is required to induce pyroptosis.

제품 프로토콜

타겟 정보

Thiol protease involved in a variety of inflammatory processes by proteolytically cleaving other proteins, such as the precursors of the inflammatory cytokines interleukin-1 beta (IL1B) and interleukin 18 (IL18) as well as the pyroptosis inducer Gasdermin-D (GSDMD), into active mature peptides (PubMed : 15326478, PubMed : 15498465, PubMed : 1574116, PubMed : 26375003, PubMed : 32051255, PubMed : 37993714, PubMed : 7876192, PubMed : 9334240). Plays a key role in cell immunity as an inflammatory response initiator : once activated through formation of an inflammasome complex, it initiates a pro-inflammatory response through the cleavage of the two inflammatory cytokines IL1B and IL18, releasing the mature cytokines which are involved in a variety of inflammatory processes (PubMed : 15326478, PubMed : 15498465, PubMed : 1574116, PubMed : 32051255, PubMed : 7876192). Cleaves a tetrapeptide after an Asp residue at position P1 (PubMed : 15498465, PubMed : 1574116, PubMed : 7876192). Also initiates pyroptosis, a programmed lytic cell death pathway, through cleavage of GSDMD (PubMed : 26375003). In contrast to cleavage of interleukin IL1B, recognition and cleavage of GSDMD is not strictly dependent on the consensus cleavage site but depends on an exosite interface on CASP1 that recognizes and binds the Gasdermin-D, C-terminal (GSDMD-CT) part (PubMed : 32051255, PubMed : 32109412, PubMed : 32553275). Cleaves and activates CASP7 in response to bacterial infection, promoting plasma membrane repair (PubMed : 22464733). Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive (PubMed : 28314590). In apoptotic cells, cleaves SPHK2 which is released from cells and remains enzymatically active extracellularly (PubMed : 20197547).. Isoform Delta. Apoptosis inactive.. Isoform Epsilon. Apoptosis inactive.
See full target information CASP1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com