JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271437

Recombinant Human CD47 protein (Biotin) (Fc tag C-Terminus + Avi tag C-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human CD47 protein (Biotin) (Fc tag C-Terminus + Avi tag C-Terminus) is a Human Fragment protein, in the 19 to 139 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE.

대체 명칭 보기

CD47, MER6, Leukocyte surface antigen CD47, Antigenic surface determinant protein OA3, Integrin-associated protein, Protein MER6, IAP

2 이미지
Size Exclusion Chromatography - Recombinant Human CD47 protein (Biotin) (Fc tag C-Terminus + Avi tag C-Terminus) (AB271437)
  • Size Exclusion Chromatography

Supplier Data

Size Exclusion Chromatography - Recombinant Human CD47 protein (Biotin) (Fc tag C-Terminus + Avi tag C-Terminus) (AB271437)

SEC analysis of ab271437.

SDS-PAGE - Recombinant Human CD47 protein (Biotin) (Fc tag C-Terminus + Avi tag C-Terminus) (AB271437)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CD47 protein (Biotin) (Fc tag C-Terminus + Avi tag C-Terminus) (AB271437)

SDS-PAGE analysis of ab271437.

주요 정보

Purity

>90% SDS-PAGE

발현 시스템

HEK 293 cells

Tags

Fc tag C-Terminus Avi tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Conjugation

Biotin

Excitation/Emission
Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.4 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.13% Sodium phosphate, 0.02% Potassium chloride

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

Enzymatically biotin-labeled using Avi-tag™ technology

서열 정보

[{"linker":null,"sequence":"QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP","proteinLength":"Fragment","predictedMolecularWeight":"42.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":139,"aminoAcidStart":19,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q08722","tags":[{"tag":"Fc","terminus":"C-Terminus"},{"tag":"Avi","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
보관 정보
Avoid freeze / thaw cycle|Store in the dark
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

CD47 also referred to as integrin-associated protein carries a molecular weight of approximately 50 kDa. This protein is broadly expressed across various cell types notably on erythrocytes leukocytes and endothelial cells. Its transmembrane glycoprotein structure allows it to perform various cellular functions. CD47 interacts with specific ligands prominently SIRPα which are present on immune cells such as macrophages and dendritic cells. The engagement of CD47 with these ligands plays a major role in cellular signaling processes.
Biological function summary

CD47 functions as a "don't eat me" signal inhibiting phagocytosis by binding to SIRPα on macrophages. This protein is also important for cell adhesion and migration and can modulate interactions with integrins. While not a part of a large complex CD47 associates with various cytoskeletal and membrane proteins to maintain cellular architecture and transmission of mechanical forces. Additionally its interaction with thrombospondins influences angiogenesis and nitric oxide signaling.

Pathways

CD47 is extensively involved in the regulation of the immune response and angiogenesis. The interaction between CD47 and SIRPα plays a part in the regulation of macrophage activity impacting the immune signaling pathway. CD47 also interacts with integrins allowing it to contribute to the angiogenesis pathway which is critical in the formation of new blood vessels. These interactions help coordinate complex cellular responses and maintain tissue homeostasis.

CD47 levels have associations with cancer and chronic inflammatory diseases. In cancer CD47 overexpression can allow tumor cells to evade the immune response by downregulating phagocytosis through SIRPα interaction. Therapeutically targeting CD47 using agents like anti-CD47 antibodies shows potential for enhancing anti-tumor immunity. Additionally CD47 is involved in atherosclerosis where its interaction with thrombospondin-1 contributes to disease pathogenesis by affecting nitric oxide signaling and vascular remodeling.

일반 정보

기능

Adhesive protein that mediates cell-to-cell interactions (PubMed : 11509594, PubMed : 15383453). Acts as a receptor for thrombospondin THBS1 and as modulator of integrin signaling through the activation of heterotrimeric G proteins (PubMed : 19004835, PubMed : 7691831, PubMed : 8550562). Involved in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, and immunoregulation (PubMed : 11509594, PubMed : 15383453, PubMed : 19004835, PubMed : 27742621, PubMed : 32679764, PubMed : 7691831, PubMed : 8550562). Plays a role in modulating pulmonary endothelin EDN1 signaling (PubMed : 27742621). Modulates nitrous oxide (NO) signaling, in response to THBS1, hence playing a role as a pressor agent, supporting blood pressure (By similarity). Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells (PubMed : 11509594). Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation (PubMed : 15383453). Positively modulates FAS-dependent apoptosis in T-cells, perhaps by enhancing FAS clustering (By similarity). Plays a role in suppressing angiogenesis and may be involved in metabolic dysregulation during normal aging (PubMed : 32679764). In response to THBS1, negatively modulates wound healing (By similarity). Inhibits stem cell self-renewal, in response to THBS1, probably by regulation of the stem cell transcription factors POU5F1/OCT4, SOX2, MYC/c-Myc and KLF4 (By similarity). May play a role in membrane transport and/or integrin dependent signal transduction (PubMed : 7691831). May prevent premature elimination of red blood cells (By similarity).

제품 프로토콜

타겟 정보

Adhesive protein that mediates cell-to-cell interactions (PubMed : 11509594, PubMed : 15383453). Acts as a receptor for thrombospondin THBS1 and as modulator of integrin signaling through the activation of heterotrimeric G proteins (PubMed : 19004835, PubMed : 7691831, PubMed : 8550562). Involved in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, and immunoregulation (PubMed : 11509594, PubMed : 15383453, PubMed : 19004835, PubMed : 27742621, PubMed : 32679764, PubMed : 7691831, PubMed : 8550562). Plays a role in modulating pulmonary endothelin EDN1 signaling (PubMed : 27742621). Modulates nitrous oxide (NO) signaling, in response to THBS1, hence playing a role as a pressor agent, supporting blood pressure (By similarity). Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells (PubMed : 11509594). Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation (PubMed : 15383453). Positively modulates FAS-dependent apoptosis in T-cells, perhaps by enhancing FAS clustering (By similarity). Plays a role in suppressing angiogenesis and may be involved in metabolic dysregulation during normal aging (PubMed : 32679764). In response to THBS1, negatively modulates wound healing (By similarity). Inhibits stem cell self-renewal, in response to THBS1, probably by regulation of the stem cell transcription factors POU5F1/OCT4, SOX2, MYC/c-Myc and KLF4 (By similarity). May play a role in membrane transport and/or integrin dependent signal transduction (PubMed : 7691831). May prevent premature elimination of red blood cells (By similarity).
See full target information CD47

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com