JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271440

Recombinant Human CD48 protein (Fc tag C-Terminus + Avi tag C-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human CD48 protein (Fc tag C-Terminus + Avi tag C-Terminus) is a Human Fragment protein, in the 27 to 220 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE.

대체 명칭 보기

CD48, BCM1, BLAST1, CD48 antigen, B-lymphocyte activation marker BLAST-1, BCM1 surface antigen, Leukocyte antigen MEM-102, SLAM family member 2, Signaling lymphocytic activation molecule 2, TCT.1, SLAMF2

2 이미지
Size Exclusion Chromatography - Recombinant Human CD48 protein (Fc tag C-Terminus + Avi tag C-Terminus) (AB271440)
  • Size Exclusion Chromatography

Supplier Data

Size Exclusion Chromatography - Recombinant Human CD48 protein (Fc tag C-Terminus + Avi tag C-Terminus) (AB271440)

SEC analysis of ab271440.

Aggregation <10%.

SDS-PAGE - Recombinant Human CD48 protein (Fc tag C-Terminus + Avi tag C-Terminus) (AB271440)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CD48 protein (Fc tag C-Terminus + Avi tag C-Terminus) (AB271440)

SDS-PAGE analysis of ab271440.

주요 정보

Purity

>90% SDS-PAGE

발현 시스템

HEK 293 cells

Tags

Fc tag C-Terminus Avi tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.4 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.13% Sodium phosphate, 0.02% Potassium chloride

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS","proteinLength":"Fragment","predictedMolecularWeight":"51 kDa","actualMolecularWeight":null,"aminoAcidEnd":220,"aminoAcidStart":27,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P09326","tags":[{"tag":"Fc","terminus":"C-Terminus"},{"tag":"Avi","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

CD48 also known as SLAMF2 or B-lymphocyte activation marker BLAST-1 is a glycosylphosphatidylinositol (GPI)-anchored protein with a molecular mass approximately 45-70 kDa depending on glycosylation. It is expressed on the surface of various immune cells like T cells B cells and natural killer (NK) cells. CD48 does not possess an intracellular signaling domain but engages in extracellular interactions with other proteins affecting immune cell activities.
Biological function summary

CD48 serves as a co-stimulatory molecule involved in immune response modulation. It interacts with 2B4 (CD244) a member of the signaling lymphocyte activation molecule (SLAM) family to form a receptor-ligand complex. This interaction can result in enhanced T cell and NK cell responses. CD48's presence on activated hematopoietic and non-hematopoietic cells highlights its role in cell-to-cell communication.

Pathways

CD48 participates in SLAM family receptor signaling and natural killer cell-mediated cytotoxicity. In the SLAM pathway CD48 enhances communication and regulation between T cells and NK cells. This communication also relates to the roles of CD244 linking it to downstream signaling pathways that influence immune cell function. These pathways illustrate the critical network CD48 is part of which impacts various immune responses.

CD48 is involved in autoimmune conditions like rheumatoid arthritis and immunological cancers such as lymphoma. In rheumatoid arthritis CD48 along with CD244 modulates immune responses which can exacerbate inflammation. In lymphoma abnormal CD48 expression can contribute to tumor progression and immune evasion indicating its potential as a therapeutic target.

일반 정보

기능

Glycosylphosphatidylinositol (GPI)-anchored cell surface glycoprotein that interacts via its N-terminal immunoglobulin domain with cell surface receptors including CD244/2B4 or CD2 to regulate immune cell function and activation (PubMed : 12007789, PubMed : 19494291, PubMed : 27249817, PubMed : 9841922). Participates in T-cell signaling transduction by associating with CD2 and efficiently bringing the Src family protein kinase LCK and LAT to the TCR/CD3 complex (PubMed : 19494291). In turn, promotes LCK phosphorylation and subsequent activation (PubMed : 12007789). Induces the phosphorylation of the cytoplasmic immunoreceptortyrosine switch motifs (ITSMs) of CD244 initiating a series of signaling events that leads to the generation of the immunological synapse and the directed release of cytolytic granules containing perforin and granzymes by T-lymphocytes and NK-cells (PubMed : 27249817).

제품 프로토콜

타겟 정보

Glycosylphosphatidylinositol (GPI)-anchored cell surface glycoprotein that interacts via its N-terminal immunoglobulin domain with cell surface receptors including CD244/2B4 or CD2 to regulate immune cell function and activation (PubMed : 12007789, PubMed : 19494291, PubMed : 27249817, PubMed : 9841922). Participates in T-cell signaling transduction by associating with CD2 and efficiently bringing the Src family protein kinase LCK and LAT to the TCR/CD3 complex (PubMed : 19494291). In turn, promotes LCK phosphorylation and subsequent activation (PubMed : 12007789). Induces the phosphorylation of the cytoplasmic immunoreceptortyrosine switch motifs (ITSMs) of CD244 initiating a series of signaling events that leads to the generation of the immunological synapse and the directed release of cytolytic granules containing perforin and granzymes by T-lymphocytes and NK-cells (PubMed : 27249817).
See full target information CD48

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com