JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB226886

Recombinant Human CD81 protein (Fc tag C-Terminus + His tag C-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human CD81 protein (Fc tag C-Terminus + His tag C-Terminus) is a Human Fragment protein, in the 113 to 201 aa range, expressed in Baculovirus infected insect cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

대체 명칭 보기

CD81, TAPA1, TSPAN28, CD81 antigen, 26 kDa cell surface protein TAPA-1, Target of the antiproliferative antibody 1, Tetraspanin-28, Tspan-28

1 이미지
SDS-PAGE - Recombinant Human CD81 protein (Fc tag C-Terminus + His tag C-Terminus) (AB226886)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CD81 protein (Fc tag C-Terminus + His tag C-Terminus) (AB226886)

15% SDS-PAGE analysis of 3 μg ab226886.

MW : 40-57 kDa (SDS-PAGE under reducing conditions).

주요 정보

Purity

>95% SDS-PAGE

Affinity purified

Endotoxin 레벨

< 1 EU/µg

발현 시스템

Baculovirus infected insect cells

Tags

Fc tag C-Terminus His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"ADPFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"37 kDa","actualMolecularWeight":null,"aminoAcidEnd":201,"aminoAcidStart":113,"nature":"Recombinant","expressionSystem":"Baculovirus infected insect cells","accessionNumber":"P60033","tags":[{"tag":"Fc","terminus":"C-Terminus"},{"tag":"His","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Affinity purification
배송 시 보관 조건
Blue Ice
적절한 단기 보관 기간
1-2 weeks
적절한 단기 보관 조건
+4°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

CD81 also known as TAPA-1 or 26 kDa protein is a member of the tetraspanin family featuring four transmembrane domains. The molecular weight of CD81 is approximately 26-28 kDa. This protein exhibits expression in numerous cell types such as leukocytes endothelial cells and epithelial tissues. CD81 plays a mechanical role by facilitating membrane protein interactions and contributing to cellular processes like adhesion and morphogenesis. Researchers have identified specific isoforms like M38 and labels like 1D6 CHAN in studies involving this target often analyzing CD81 through techniques like Western blot to determine expression levels and molecular weight.
Biological function summary

CD81 interacts with other tetraspanins and forms complexes within the membrane to regulate cellular signaling trafficking and adhesion. It participates in the assembly of larger tetraspanin-enriched microdomains which are important for efficient signaling and functional variety. These complexes modulate cell morphology proliferation and development influencing immune responses and pathogen entry to cells. The presence of CD81 in diverse tissues implies its involvement in a wide range of cellular processes forming essential complexes with proteins like integrins that further engage in tissue repair and immunological defense.

Pathways

CD81 plays significant roles in the immune system and viral entry pathways. It interacts with other proteins like CD9 and CD19 within the immune response pathways regulating lymphocyte activation and differentiation. CD81 is notably a coreceptor in the hepatitis C virus (HCV) entry pathway facilitating viral attachment and fusion into host cells. These interactions illustrate CD81's involvement in modulation of immune cell responses and influence on pathogen infection processes integrating into the complex cellular pathways important for maintaining homeostasis and response to external stimuli.

CD81 has connections to hepatitis C virus (HCV) infections and immunological disorders such as systemic lupus erythematosus (SLE). During HCV infection CD81 serves as an important entry point for the virus interacting with proteins like claudin-1 and scavenger receptor class B type I (SR-BI) enabling viral entry and replication within liver cells. In SLE alterations in CD81 expression can impact autoantibody production and lymphocyte behavior contributing to the disease's pathology. Understanding CD81's role in these diseases provides insight into therapeutic targets and potential interventions for managing infections and autoimmune responses.

일반 정보

기능

Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling. Essential for trafficking and compartmentalization of CD19 receptor on the surface of activated B cells (PubMed : 16449649, PubMed : 20237408, PubMed : 27881302). Upon initial encounter with microbial pathogens, enables the assembly of CD19-CR2/CD21 and B cell receptor (BCR) complexes at signaling TERMs, lowering the threshold dose of antigen required to trigger B cell clonal expansion and antibody production (PubMed : 15161911, PubMed : 20237408). In T cells, facilitates the localization of CD247/CD3 zeta at antigen-induced synapses with B cells, providing for costimulation and polarization toward T helper type 2 phenotype (PubMed : 22307619, PubMed : 23858057, PubMed : 8766544). Present in MHC class II compartments, may also play a role in antigen presentation (PubMed : 8409388, PubMed : 8766544). Can act both as positive and negative regulator of homotypic or heterotypic cell-cell fusion processes. Positively regulates sperm-egg fusion and may be involved in acrosome reaction (By similarity). In myoblasts, associates with CD9 and PTGFRN and inhibits myotube fusion during muscle regeneration (By similarity). In macrophages, associates with CD9 and beta-1 and beta-2 integrins, and prevents macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles (PubMed : 12796480). Also prevents the fusion of mononuclear cell progenitors into osteoclasts in charge of bone resorption (By similarity). May regulate the compartmentalization of enzymatic activities. In T cells, defines the subcellular localization of dNTPase SAMHD1 and permits its degradation by the proteasome, thereby controlling intracellular dNTP levels (PubMed : 28871089). Also involved in cell adhesion and motility. Positively regulates integrin-mediated adhesion of macrophages, particularly relevant for the inflammatory response in the lung (By similarity).. (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) in hepatocytes. Association with CLDN1 and the CLDN1-CD81 receptor complex is essential for HCV entry into host cell.. (Microbial infection) Involved in SAMHD1-dependent restriction of HIV-1 replication. May support early replication of both R5- and X4-tropic HIV-1 viruses in T cells, likely via proteasome-dependent degradation of SAMHD1.. (Microbial infection) Specifically required for Plasmodium falciparum infectivity of hepatocytes, controlling sporozoite entry into hepatocytes via the parasitophorous vacuole and subsequent parasite differentiation to exoerythrocytic forms.

서열 유사성

Belongs to the tetraspanin (TM4SF) family.

Post-translational modifications

Not glycosylated.. Likely constitutively palmitoylated at low levels. Protein palmitoylation is up-regulated upon coligation of BCR and CD9-C2R-CD81 complexes in lipid rafts.

제품 프로토콜

타겟 정보

Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling. Essential for trafficking and compartmentalization of CD19 receptor on the surface of activated B cells (PubMed : 16449649, PubMed : 20237408, PubMed : 27881302). Upon initial encounter with microbial pathogens, enables the assembly of CD19-CR2/CD21 and B cell receptor (BCR) complexes at signaling TERMs, lowering the threshold dose of antigen required to trigger B cell clonal expansion and antibody production (PubMed : 15161911, PubMed : 20237408). In T cells, facilitates the localization of CD247/CD3 zeta at antigen-induced synapses with B cells, providing for costimulation and polarization toward T helper type 2 phenotype (PubMed : 22307619, PubMed : 23858057, PubMed : 8766544). Present in MHC class II compartments, may also play a role in antigen presentation (PubMed : 8409388, PubMed : 8766544). Can act both as positive and negative regulator of homotypic or heterotypic cell-cell fusion processes. Positively regulates sperm-egg fusion and may be involved in acrosome reaction (By similarity). In myoblasts, associates with CD9 and PTGFRN and inhibits myotube fusion during muscle regeneration (By similarity). In macrophages, associates with CD9 and beta-1 and beta-2 integrins, and prevents macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles (PubMed : 12796480). Also prevents the fusion of mononuclear cell progenitors into osteoclasts in charge of bone resorption (By similarity). May regulate the compartmentalization of enzymatic activities. In T cells, defines the subcellular localization of dNTPase SAMHD1 and permits its degradation by the proteasome, thereby controlling intracellular dNTP levels (PubMed : 28871089). Also involved in cell adhesion and motility. Positively regulates integrin-mediated adhesion of macrophages, particularly relevant for the inflammatory response in the lung (By similarity).. (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) in hepatocytes. Association with CLDN1 and the CLDN1-CD81 receptor complex is essential for HCV entry into host cell.. (Microbial infection) Involved in SAMHD1-dependent restriction of HIV-1 replication. May support early replication of both R5- and X4-tropic HIV-1 viruses in T cells, likely via proteasome-dependent degradation of SAMHD1.. (Microbial infection) Specifically required for Plasmodium falciparum infectivity of hepatocytes, controlling sporozoite entry into hepatocytes via the parasitophorous vacuole and subsequent parasite differentiation to exoerythrocytic forms.
See full target information CD81

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com