JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276485

Recombinant Human CD93 protein (His tag)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human CD93 protein (His tag) is a Human Fragment protein, in the 1 to 580 aa range, expressed in HEK 293 cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

대체 명칭 보기

CD93, C1QR1, MXRA4, Complement component C1q receptor, C1q/MBL/SPA receptor, CDw93, Complement component 1 q subcomponent receptor 1, Matrix-remodeling-associated protein 4, C1qR, C1qR(p), C1qRp

1 이미지
SDS-PAGE - Recombinant Human CD93 protein (His tag) (AB276485)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CD93 protein (His tag) (AB276485)

SDS-PAGE analysis of ab276485

주요 정보

Purity

>90% SDS-PAGE

Endotoxin 레벨

< 1 EU/µg

발현 시스템

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MATSMGLLLLLLLLLTQPGAGTGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK","proteinLength":"Fragment","predictedMolecularWeight":"59.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":580,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9NPY3","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

CD93 also known as C1q receptor and a type I transmembrane glycoprotein weighs approximately 68 kDa. This protein is mainly expressed on platelets monocytes endothelial cells and some cell lines within the immune system. CD93 is known for engaging in cell adhesion and phagocytosis processes. It has a notable presence on the surface of circulating cells indicating its involvement in physiological interactions essential for cellular communication.
Biological function summary

CD93 contributes to cellular processes through its role in the clearance of apoptotic cells and immune surveillance. It also partakes in angiogenesis facilitating the growth of new blood vessels. CD93 often functions as part of a larger complex in binding with other molecules to support cellular communication. By modulating the immune response CD93 ensures efficient removal of cellular debris maintaining homeostasis and preventing autoimmune reactions.

Pathways

CD93 operates within the innate immune response and complement system pathways. It closely interacts with other proteins such as C1q which is part of the complement activation pathway. This interaction supports the clearance of immune complexes and cellular debris. By facilitating these processes CD93 aids in maintaining the balance between immune activation and tolerance.

CD93 has associations with inflammatory diseases and cancer progression. In inflammatory diseases its role in the immune system implicates it in conditions characterized by excessive inflammation often relating to the misregulation of immune functions. As for cancer CD93's involvement in angiogenesis links it to tumor growth with connections seen alongside vascular endothelial growth factor (VEGF) pathways. These insights into CD93's role suggest its potential as a therapeutic target in treating related pathological states.

일반 정보

기능

Cell surface receptor that plays a role in various physiological processes including inflammation, phagocytosis, and cell adhesion. Plays a role in phagocytosis and enhances the uptake of apoptotic cells and immune complexes by acting as a receptor for defense collagens including surfactant protein A/SFTPA1, C1q, and mannose-binding lectin (MBL2) (PubMed : 7977768). Plays a role in the regulation of endothelial cell function and adhesion by activating angiogenesis (PubMed : 24809468). Mechanistically, exerts its angiogenic function by associating with beta-dystroglycan, leading to SRC-dependent phosphorylation and subsequent recruitment of CBL. In turn, CBL provides a docking site for downstream signaling components, such as CRKL to enhance cell migration (PubMed : 26848865). Participates in angiogenesis also by acting as a receptor for the ECM pan-endothelial glycoprotein multimerin-2/MMRN2 and IGFBP7 ligands (PubMed : 28671670, PubMed : 36265539, PubMed : 38218180). Both ligands play a non-redundant role in CD93-mediated endothelial cell function (PubMed : 38218180). Acts as a key regulator of endothelial barrier function through modulating VEGFR2 function (By similarity).

Post-translational modifications

N- and O-glycosylated.. Phosphorylated on Tyr-628 and Tyr-644 by SRC; these phosphorylations promote endothelial cell adhesion and migration.

제품 프로토콜

타겟 정보

Cell surface receptor that plays a role in various physiological processes including inflammation, phagocytosis, and cell adhesion. Plays a role in phagocytosis and enhances the uptake of apoptotic cells and immune complexes by acting as a receptor for defense collagens including surfactant protein A/SFTPA1, C1q, and mannose-binding lectin (MBL2) (PubMed : 7977768). Plays a role in the regulation of endothelial cell function and adhesion by activating angiogenesis (PubMed : 24809468). Mechanistically, exerts its angiogenic function by associating with beta-dystroglycan, leading to SRC-dependent phosphorylation and subsequent recruitment of CBL. In turn, CBL provides a docking site for downstream signaling components, such as CRKL to enhance cell migration (PubMed : 26848865). Participates in angiogenesis also by acting as a receptor for the ECM pan-endothelial glycoprotein multimerin-2/MMRN2 and IGFBP7 ligands (PubMed : 28671670, PubMed : 36265539, PubMed : 38218180). Both ligands play a non-redundant role in CD93-mediated endothelial cell function (PubMed : 38218180). Acts as a key regulator of endothelial barrier function through modulating VEGFR2 function (By similarity).
See full target information CD93

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com