JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB167727

Recombinant human CTLA4 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human CTLA4 protein (Active) is a Human Fragment protein, in the 37 to 162 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, ELISA, FuncS.

대체 명칭 보기

CD152, CTLA4, Cytotoxic T-lymphocyte protein 4, Cytotoxic T-lymphocyte-associated antigen 4, CTLA-4

4 Images
Functional Studies - Recombinant human CTLA4 protein (Active) (AB167727)
  • FuncS

Supplier Data

Functional Studies - Recombinant human CTLA4 protein (Active) (AB167727)

Yervoy (Ipilimumab, Human IgG1) captured on CM5 chip via anti-human IgG Fc antibodies surface, can bind ab167727 with an affinity constant of 25.7 nM as determined in SPR assay.

ELISA - Recombinant human CTLA4 protein (Active) (AB167727)
  • ELISA

Supplier Data

ELISA - Recombinant human CTLA4 protein (Active) (AB167727)

Immobilized Human B7-2, Fc Tag (ab167720) at 2μg/mL (100 μL/well) can bind ab167727 with a linear range of 1-6.4 ng/mL.

ELISA - Recombinant human CTLA4 protein (Active) (AB167727)
  • ELISA

Supplier Data

ELISA - Recombinant human CTLA4 protein (Active) (AB167727)

Immobilized Human B7-1, Fc Tag (ab173993) at 2μg/mL (100 μL/well) can bind ab167727 with a linear range of 0.16-2.56 ng/mL.

SDS-PAGE - Recombinant human CTLA4 protein (Active) (AB167727)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human CTLA4 protein (Active) (AB167727)

SDS-PAGE of reduced ab167727 stained overnight with Coomassie Blue. The protein migrates as 25-30 kDa under reducing conditions due to glycosylation.

주요 정보

Purity

>95% SDS-PAGE

Endotoxin 레벨

< 1 EU/µg

발현 시스템

HEK 293 cells

Tags

His tag C-Terminus

Applications

FuncS, SDS-PAGE, ELISA

applications

Biologically active

Yes

Biological activity

Measured by its binding ability in a functional ELISA. Immobilized Human B7-1, Fc Tag (ab173993) at 2μg/mL (100 μL/well) can bind ab167727 with a linear range of 0.16-2.56 ng/mL.

Measured by its binding ability in a functional ELISA. Immobilized Human B7-2, Fc Tag (ab167720) at 2μg/mL (100 μL/well) can bind ab167727 with a linear range of 1-6.4 ng/mL.

Measured by its binding ability in an SPR assay. Yervoy (Ipilimumab, Human IgG1) captured on CM5 chip via anti-human IgG Fc antibodies surface, can bind ab167727 with an affinity constant of 25.7 nM.

Accession

P16410

Animal free

No

Carrier free

Yes

Species

Human

Reconstitution

Reconstitute with sterile deionized water to a concentration of 200 µg/ml.

보관 버퍼

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"sequence":"AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF","proteinLength":"Fragment","predictedMolecularWeight":"14.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":162,"aminoAcidStart":37,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P16410","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Blue Ice
적절한 단기 보관 기간
1-2 weeks
적절한 단기 보관 조건
+4°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

CTLA-4 also known as CD152 is an immune checkpoint receptor with a molecular weight of approximately 34 kDa. This protein is expressed on the surface of T-cells especially after activation and sometimes on regulatory T-cells (Tregs). CTLA-4 competes with CD28 for binding to the same ligands CD80 and CD86 on antigen-presenting cells. Unlike CD28 which stimulates T-cell activation CTLA-4 sends inhibitory signals to downregulate immune responses. By doing this CTLA-4 helps maintain immune system homeostasis and prevents autoimmune reactions.
Biological function summary

The CTLA-4 protein functions as a critical regulator of the immune system. It interacts with CD80/CD86 in a complex that effectively transmits inhibitory signals to T-cells. CTLA-4 controls the amplitude of the initial activation of T-cells ensuring that the body's immune responses are kept under control. In regulatory T-cells CTLA-4 engagement contributes to their immunosuppressive functions through which they maintain tolerance to self-antigens and prevent overactive immune reactions.

Pathways

CTLA-4 involves itself in the adaptive immune response pathways specifically the regulation of T-cell activity. CTLA-4's interaction with CD80/CD86 modulates pathways associated with TCR (T-cell receptor) signaling. When CTLA-4 binds its ligands it recruits phosphatases such as SHP-2 that dephosphorylate signaling proteins leading to the downregulation of T-cell interaction. This pathway interaction exemplifies how CTLA-4 acts in concert with proteins like CD28 to finely tune immune responses.

CTLA-4 plays a role in autoimmune diseases and cancer. The dysregulation of CTLA-4 function can lead to autoimmune disorders where the immune system attacks the body's own tissue. In cancer tumor cells may manipulate CTLA-4 pathways to evade immune surveillance. Targeted therapies like anti-CTLA-4 antibodies such as ipilimumab have been developed to block CTLA-4 aiming to enhance the immune system’s ability to attack cancer cells. These treatments highlight the role of CTLA-4 in balancing immune activity and the potential to alter this balance for therapeutic benefit.

일반 정보

기능

Inhibitory receptor acting as a major negative regulator of T-cell responses (PubMed : 11279501, PubMed : 11279502, PubMed : 16551244, PubMed : 1714933, PubMed : 18641304, PubMed : 28484017). Acts as a decoy receptor : the affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28 (PubMed : 11279501, PubMed : 11279502, PubMed : 16551244, PubMed : 1714933, PubMed : 28484017).

Post-translational modifications

N-glycosylation is important for dimerization.. Phosphorylation at Tyr-201 prevents binding to the AP-2 adapter complex, blocks endocytosis, and leads to retention of CTLA4 on the cell surface.

제품 프로토콜

타겟 정보

Inhibitory receptor acting as a major negative regulator of T-cell responses (PubMed : 11279501, PubMed : 11279502, PubMed : 16551244, PubMed : 1714933, PubMed : 18641304, PubMed : 28484017). Acts as a decoy receptor : the affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28 (PubMed : 11279501, PubMed : 11279502, PubMed : 16551244, PubMed : 1714933, PubMed : 28484017).
See full target information CTLA4

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com