JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276226

Recombinant Human DC-SIGN protein (Fc Chimera)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human DC-SIGN protein (Fc Chimera) is a Human Fragment protein, in the 62 to 404 aa range, expressed in HEK 293 cells, with >97%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

대체 명칭 보기

CD209, CLEC4L, CD209 antigen, C-type lectin domain family 4 member L, Dendritic cell-specific ICAM-3-grabbing non-integrin 1, DC-SIGN, DC-SIGN1

1 이미지
SDS-PAGE - Recombinant Human DC-SIGN protein (Fc Chimera) (AB276226)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human DC-SIGN protein (Fc Chimera) (AB276226)

SDS-PAGE analysis of ab276226

주요 정보

Purity

>97% SDS-PAGE

Endotoxin 레벨

< 1 EU/µg

발현 시스템

HEK 293 cells

Tags

Fc tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"KVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA","proteinLength":"Fragment","predictedMolecularWeight":"65.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":404,"aminoAcidStart":62,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9NNX6","tags":[{"tag":"Fc","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

일반 정보

기능

Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. The receptor returns to the cell membrane surface and the pathogen-derived antigens are presented to resting T-cells via MHC class II proteins to initiate the adaptive immune response.. On dendritic cells (DCs) it is a high affinity receptor for ICAM2 and ICAM3 by binding to mannose-like carbohydrates (PubMed : 10721994, PubMed : 10721995, PubMed : 11017109, PubMed : 12574325). May act as a DC rolling receptor that mediates transendothelial migration of DC presursors from blood to tissues by binding endothelial ICAM2 (PubMed : 11017109). Forms a first contact between DC and resting T cell, througth ICAM3 binding, facilitating the downstream DC-T cell clustering process and DC-induced proliferation of resting T Cells (PubMed : 10721994, PubMed : 10721995).. (Microbial infection) Acts as an attachment receptor for HIV-1 and HIV-2.. (Microbial infection) Acts as an attachment receptor for Ebolavirus.. (Microbial infection) Acts as an attachment receptor for Cytomegalovirus.. (Microbial infection) Acts as an attachment receptor for HCV.. (Microbial infection) Acts as an attachment receptor for Dengue virus.. (Microbial infection) Acts as an attachment receptor for Measles virus.. (Microbial infection) Acts as an attachment receptor for Herpes simplex virus 1.. (Microbial infection) Acts as an attachment receptor for Influenzavirus A.. (Microbial infection) Acts as an attachment receptor for SARS-CoV.. (Microbial infection) Acts as an attachment receptor for Japanese encephalitis virus.. (Microbial infection) Acts as an attachment receptor for Lassa virus (PubMed : 23966408). Acts as an attachment receptor for Marburg virusn.. (Microbial infection) Acts as an attachment receptor for Respiratory syncytial virus.. (Microbial infection) Acts as an attachment receptor for Rift valley fever virus and uukuniemi virus.. (Microbial infection) Acts as an attachment receptor for West-nile virus.. (Microbial infection) Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of bacterial pathogen antigens, including Leishmania pifanoi LPG, Lewis-x antigen in Helicobacter pylori LPS, mannose in Klebsiella pneumonae LPS, di-mannose and tri-mannose in Mycobacterium tuberculosis ManLAM and Lewis-x antigen in Schistosoma mansoni SEA (PubMed : 16379498). Recognition of M.tuberculosis by dendritic cells occurs partially via this molecule (PubMed : 16092920, PubMed : 21203928).

제품 프로토콜

타겟 정보

Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. The receptor returns to the cell membrane surface and the pathogen-derived antigens are presented to resting T-cells via MHC class II proteins to initiate the adaptive immune response.. On dendritic cells (DCs) it is a high affinity receptor for ICAM2 and ICAM3 by binding to mannose-like carbohydrates (PubMed : 10721994, PubMed : 10721995, PubMed : 11017109, PubMed : 12574325). May act as a DC rolling receptor that mediates transendothelial migration of DC presursors from blood to tissues by binding endothelial ICAM2 (PubMed : 11017109). Forms a first contact between DC and resting T cell, througth ICAM3 binding, facilitating the downstream DC-T cell clustering process and DC-induced proliferation of resting T Cells (PubMed : 10721994, PubMed : 10721995).. (Microbial infection) Acts as an attachment receptor for HIV-1 and HIV-2.. (Microbial infection) Acts as an attachment receptor for Ebolavirus.. (Microbial infection) Acts as an attachment receptor for Cytomegalovirus.. (Microbial infection) Acts as an attachment receptor for HCV.. (Microbial infection) Acts as an attachment receptor for Dengue virus.. (Microbial infection) Acts as an attachment receptor for Measles virus.. (Microbial infection) Acts as an attachment receptor for Herpes simplex virus 1.. (Microbial infection) Acts as an attachment receptor for Influenzavirus A.. (Microbial infection) Acts as an attachment receptor for SARS-CoV.. (Microbial infection) Acts as an attachment receptor for Japanese encephalitis virus.. (Microbial infection) Acts as an attachment receptor for Lassa virus (PubMed : 23966408). Acts as an attachment receptor for Marburg virusn.. (Microbial infection) Acts as an attachment receptor for Respiratory syncytial virus.. (Microbial infection) Acts as an attachment receptor for Rift valley fever virus and uukuniemi virus.. (Microbial infection) Acts as an attachment receptor for West-nile virus.. (Microbial infection) Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of bacterial pathogen antigens, including Leishmania pifanoi LPG, Lewis-x antigen in Helicobacter pylori LPS, mannose in Klebsiella pneumonae LPS, di-mannose and tri-mannose in Mycobacterium tuberculosis ManLAM and Lewis-x antigen in Schistosoma mansoni SEA (PubMed : 16379498). Recognition of M.tuberculosis by dendritic cells occurs partially via this molecule (PubMed : 16092920, PubMed : 21203928).
See full target information CD209

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com