JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB167833

Recombinant Human Dhh protein (His tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Dhh protein (His tag N-Terminus) is a Human Full Length protein, in the 23 to 198 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

대체 명칭 보기

Desert hedgehog protein, DHH, HHG-3

1 이미지
SDS-PAGE - Recombinant Human Dhh protein (His tag N-Terminus) (AB167833)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Dhh protein (His tag N-Terminus) (AB167833)

15% SDS-PAGE analysis of ab167833 (3µg).

주요 정보

Purity

>90% SDS-PAGE

ab167833 was purified using conventional chromatography techniques.

발현 시스템

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.5 Constituents: 10% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMIIGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG","proteinLength":"Full Length","predictedMolecularWeight":"22.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":198,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O43323","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 기간
1-2 weeks
적절한 단기 보관 조건
+4°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

The protein 'Desert Hedgehog' (Dhh) also known as DHH weighs approximately 42 kDa and plays an important role in signaling pathways. Dhh functions mechanically by sending signals that control cell growth and differentiation during embryonic development. This protein expresses in specific tissues such as the gonads and is especially associated with Sertoli cells in the testes.
Biological function summary

Dhh contributes to the regulation of morphogenesis and tissue patterning. Dhh forms part of the Hedgehog signaling pathway a critical signaling complex needed for the communication between cells. This interaction is important for cellular processes such as growth survival and differentiation. The protein is critical in development and is significant for the proper formation of various organs and tissues.

Pathways

Its involvement with the Hedgehog signaling pathway is essential. This pathway impacts the development of several structures and organs by regulating gene expression. Other proteins involved in this pathway include Patched1 (PTCH1) and Smoothened (SMO). Pathway deregulation can lead to issues and is a significant area of study in several types of biological research.

Dhh has links to conditions like gonadal dysgenesis and peripheral neuropathy. Abnormal function or expression of the Dhh protein can lead to developmental defects or contribute toward disease progression. The interaction with other proteins such as PTCH1 further highlights its involvement in the pathogenesis of these conditions. Understanding Dhh’s role offers potential insights into therapeutic interventions for these diseases.

일반 정보

기능

Desert hedgehog protein. The C-terminal part of the desert hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity (By similarity). Both activities result in the cleavage of the full-length protein into two parts (N-product and C-product) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product (DHH-N) (By similarity). Both activities occur in the endoplasmic reticulum (By similarity). Once cleaved, the C-product is degraded in the endoplasmic reticulum (By similarity). Functions in cell-cell mediated juxtacrine signaling (PubMed : 24342078). Promotes endothelium integrity (PubMed : 33063110). Binds to PTCH1 receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes in endothelial cells (PubMed : 33063110). In Schwann cells, controls the development of the peripheral nerve sheath and the transition of mesenchymal cells to form the epithelium-like structure of the perineurial tube (By similarity).. Desert hedgehog protein N-product. The dually lipidated desert hedgehog protein N-product is essential for a variety of patterning events during development (By similarity). Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes (PubMed : 11472839, PubMed : 33063110). Required for normal testis development and spermatogenesis, namely for the formation of adult-type Leydig cells and normal development of peritubular cells and seminiferous tubules (By similarity). Activates primary cilia signaling on neighboring valve interstitial cells through a paracrine mechanism (By similarity). May induce motor neurons in lateral neural tube and may have a polarizing activity (PubMed : 11472839). Prevents the desert hedgehog protein precursor binding to PTCH1 (PubMed : 33063110).

서열 유사성

Belongs to the hedgehog family.

Post-translational modifications

Desert hedgehog protein. Partially autoproteolyzed (PubMed:24342078, PubMed:30298535). The C-terminal domain displays an autoproteolysis activity and a cholesterol transferase activity (By similarity). Both activities result in the cleavage of the full-length protein into two parts (N-product and C-product) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product (DHH-N) (By similarity). DHH-N is the active species, whereas the C-product is degraded in the endoplasmic reticulum (By similarity).. Desert hedgehog protein N-product. N-palmitoylation by HHAT is required for desert hedgehog protein N-product multimerization and full activity (By similarity).

제품 프로토콜

타겟 정보

Desert hedgehog protein. The C-terminal part of the desert hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity (By similarity). Both activities result in the cleavage of the full-length protein into two parts (N-product and C-product) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product (DHH-N) (By similarity). Both activities occur in the endoplasmic reticulum (By similarity). Once cleaved, the C-product is degraded in the endoplasmic reticulum (By similarity). Functions in cell-cell mediated juxtacrine signaling (PubMed : 24342078). Promotes endothelium integrity (PubMed : 33063110). Binds to PTCH1 receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes in endothelial cells (PubMed : 33063110). In Schwann cells, controls the development of the peripheral nerve sheath and the transition of mesenchymal cells to form the epithelium-like structure of the perineurial tube (By similarity).. Desert hedgehog protein N-product. The dually lipidated desert hedgehog protein N-product is essential for a variety of patterning events during development (By similarity). Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes (PubMed : 11472839, PubMed : 33063110). Required for normal testis development and spermatogenesis, namely for the formation of adult-type Leydig cells and normal development of peritubular cells and seminiferous tubules (By similarity). Activates primary cilia signaling on neighboring valve interstitial cells through a paracrine mechanism (By similarity). May induce motor neurons in lateral neural tube and may have a polarizing activity (PubMed : 11472839). Prevents the desert hedgehog protein precursor binding to PTCH1 (PubMed : 33063110).
See full target information DHH

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com