JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB290061

Recombinant Human DR5 Protein (Active)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human DR5 Protein (Active) is a Human Fragment protein, in the 54 to 210 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for HPLC, Mass Spec, SDS-PAGE, FuncS.

대체 명칭 보기

CD262, DR5, KILLER, TRAILR2, TRICK2, ZTNFR9, UNQ160/PRO186, TNFRSF10B, Tumor necrosis factor receptor superfamily member 10B, Death receptor 5, TNF-related apoptosis-inducing ligand receptor 2, TRAIL receptor 2, TRAIL-R2

4 이미지
Functional Studies - Recombinant Human DR5 Protein (Active) (AB290061)
  • FuncS

Supplier Data

Functional Studies - Recombinant Human DR5 Protein (Active) (AB290061)

Fully biologically active determined by its ability to inhibit Trail-induced apoptosis in LN-18 cells.  ED50 is ≤ 12.7 ng/ml, corresponding to a specific activity of 7.87 x 10^4 units/mg.

Mass Spectrometry - Recombinant Human DR5 Protein (Active) (AB290061)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human DR5 Protein (Active) (AB290061)

Mass determination by ESI-TOF. Predicted MW is 17211.11 Da (+/-10 Da by ESI-TOF). Observed MW is 17210.87 Da.

HPLC - Recombinant Human DR5 Protein (Active) (AB290061)
  • HPLC

Supplier Data

HPLC - Recombinant Human DR5 Protein (Active) (AB290061)

HPLC analysis of ab290061

SDS-PAGE - Recombinant Human DR5 Protein (Active) (AB290061)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human DR5 Protein (Active) (AB290061)

SDS-PAGE analysis of ab290061

주요 정보

Purity

>95% HPLC

SDS-PAGE >= 95%

Endotoxin 레벨

<0.005 EU/µg

발현 시스템

HEK 293 cells

Tags

Tag free

Applications

Mass Spec, SDS-PAGE, FuncS, HPLC

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by its ability to inhibit Trail-induced apoptosis in LN-18 cells.

ED50 is ≤ 12.7 ng/ml, corresponding to a specific activity of 7.87 x 104 units/mg.

Accession

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

보관 버퍼

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKESGTKHSGEVPAVEETVTSSPGTPASPCS","proteinLength":"Fragment","predictedMolecularWeight":"17.21 kDa","actualMolecularWeight":"17.21 kDa","aminoAcidEnd":210,"aminoAcidStart":54,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"O14763","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

DR5 also known as Death Receptor 5 TRAIL-R2 or TNFRSF10B is a protein critical in apoptosis. It is a transmembrane receptor with a mass of approximately 54 kDa. Researchers find it expressed mostly in tissues such as lung colon and prostate. DR5 functions by binding to its ligand TRAIL triggering the extrinsic apoptotic pathway. Through this mechanism DR5 initiates a cascade of caspase activation that leads to cell death.
Biological function summary

DR5 plays a significant role in the regulation of apoptosis particularly in cancer cells. It is a component of the TRAIL receptor complex which includes several other death receptors like DR4. This complex formation allows DR5 to mediate apoptotic signals more efficiently. By controlling apoptosis DR5 helps maintain tissue homeostasis and prevents abnormal cell proliferation.

Pathways

DR5 is an important part of the TRAIL signaling pathway and the extrinsic apoptosis pathway. It connects with proteins like FADD and Caspase-8 essential in the apoptotic signaling cascade. By interacting with these proteins DR5 drives the progression of the apoptotic signal ensuring the removal of dysfunctional cells. Such pathways are vital for restraining tumor development and progression.

DR5 exhibits significant relevance to cancer and autoimmune diseases. Its ability to induce apoptosis through the TRAIL pathway keeps oncogenic transformations in check. In cancer DR5 often interfaces with other proteins like Bcl-2 which are involved in cell survival. Furthermore defects or aberrant expressions in DR5 have associations with autoimmune disorders where excessive cell death or survival contributes to disease pathology. DR5's role in these conditions makes it a promising target in therapeutic strategies.

일반 정보

기능

Receptor for the cytotoxic ligand TNFSF10/TRAIL (PubMed : 10549288). The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.

Post-translational modifications

(Microbial infection) Glycosylated on Arg residue by S.typhimurium protein Ssek3.

제품 프로토콜

타겟 정보

Receptor for the cytotoxic ligand TNFSF10/TRAIL (PubMed : 10549288). The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.
See full target information TNFRSF10B

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com