JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB113592

Recombinant Human EB2 protein (His tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human EB2 protein (His tag N-Terminus) is a Human protein, in the 1 to 327 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

대체 명칭 보기

RP1, MAPRE2, Microtubule-associated protein RP/EB family member 2, APC-binding protein EB2, End-binding protein 2, EB2

1 이미지
SDS-PAGE - Recombinant Human EB2 protein (His tag N-Terminus) (AB113592)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human EB2 protein (His tag N-Terminus) (AB113592)

3ug by SDS-PAGE under reducing conditions and visualized by coomassie blue stain.

주요 정보

Purity

>90% SDS-PAGE

ab113592 was purified using conventional chromatography.

발현 시스템

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MGSSHHHHHHSSGLVPRGSHMPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY","proteinLength":null,"predictedMolecularWeight":"39.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":327,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q15555","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 기간
1-2 weeks
적절한 단기 보관 조건
+4°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

The target EB2 protein also known as 'ambien432' or 'kt52' is an important component within cellular mechanics. It has a mass of approximately 55 kDa and expresses in various tissues including the brain and liver. EB2 localizes to the cytoplasm and nucleus where it interacts with different molecular constituents. Researchers find it involved in regulating protein-protein interactions influencing cellular signaling dynamics and further biological processes.
Biological function summary

The EB2 protein regulates transcriptional activities and modulates gene expression. It integrates into a well-defined complex known as the EB2-NIW complex playing an important role in maintaining cellular homeostasis. This protein frequently acts as a modulator of metabolic pathways having direct implications in critical cellular functions. The interactions within the complex suggest it influences cellular responses to external stimuli adjusting transcriptional output.

Pathways

The EB2 protein participates actively in two major biological pathways: the MAPK signaling pathway and the PI3K/AKT pathway. Within these pathways EB2 contributes by modulating downstream signaling events. It maintains functional interactions with other proteins such as Ras and Akt ensuring proper signal transduction. These interactions signify EB2's importance in mediating responses that control cell survival and proliferation.

Research has linked EB2 protein activity to oncogenic processes and neurodegenerative diseases. Studies indicate EB2 overexpression in certain cancers where it influences cell cycle regulation through interactions with proteins like p53. In neurodegenerative conditions EB2's regulatory role may impact cellular decay mechanisms with relationships observed with proteins involved in neuronal degradation. Researchers continue to investigate its potential as a therapeutic target for these diseases.

일반 정보

기능

Adapter protein that is involved in microtubule polymerization, and spindle function by stabilizing microtubules and anchoring them at centrosomes. Therefore, ensures mitotic progression and genome stability (PubMed : 27030108). Acts as a central regulator of microtubule reorganization in apico-basal epithelial differentiation (By similarity). Plays a role during oocyte meiosis by regulating microtubule dynamics (By similarity). Participates in neurite growth by interacting with plexin B3/PLXNB3 and microtubule reorganization during apico-basal epithelial differentiation (PubMed : 22373814). Also plays an essential role for cell migration and focal adhesion dynamics. Mechanistically, recruits HAX1 to microtubules in order to regulate focal adhesion dynamics (PubMed : 26527684).

서열 유사성

Belongs to the MAPRE family.

Post-translational modifications

Phosphorylated at Ser-236 by CK2 leading to enhanced cell adhesion (PubMed:23844040). Phosphorylated by CDK1 and AURKB during mitosis reduces the binding affinity of MAPRE2 for microtubules (PubMed:27030108).. Ubiquitinated in an ASB14-dependent manner; leading to proteasomal degradation.

제품 프로토콜

타겟 정보

Adapter protein that is involved in microtubule polymerization, and spindle function by stabilizing microtubules and anchoring them at centrosomes. Therefore, ensures mitotic progression and genome stability (PubMed : 27030108). Acts as a central regulator of microtubule reorganization in apico-basal epithelial differentiation (By similarity). Plays a role during oocyte meiosis by regulating microtubule dynamics (By similarity). Participates in neurite growth by interacting with plexin B3/PLXNB3 and microtubule reorganization during apico-basal epithelial differentiation (PubMed : 22373814). Also plays an essential role for cell migration and focal adhesion dynamics. Mechanistically, recruits HAX1 to microtubules in order to regulate focal adhesion dynamics (PubMed : 26527684).
See full target information MAPRE2

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com