JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB113867

Recombinant Human Ephrin A1 protein (denatured) (His tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Ephrin A1 protein (denatured) (His tag N-Terminus) is a Human Full Length protein, in the 19 to 182 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

대체 명칭 보기

EPLG1, LERK1, TNFAIP4, EFNA1, Ephrin-A1, EPH-related receptor tyrosine kinase ligand 1, Immediate early response protein B61, Tumor necrosis factor alpha-induced protein 4, LERK-1, TNF alpha-induced protein 4

1 이미지
SDS-PAGE - Recombinant Human Ephrin A1 protein (denatured) (His tag N-Terminus) (AB113867)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Ephrin A1 protein (denatured) (His tag N-Terminus) (AB113867)

3ug by SDS-PAGE under reducing conditions and visualized by coomassie blue stain.

주요 정보

Purity

>90% SDS-PAGE

발현 시스템

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MGSSHHHHHHSSGLVPRGSHMDRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHVNPQEKRLAADDPEVRVLHSIGHS","proteinLength":"Full Length","predictedMolecularWeight":"21.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":182,"aminoAcidStart":19,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P20827","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 기간
1-2 weeks
적절한 단기 보관 조건
+4°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Ephrin A1 also known as EFNA1 is a membrane-bound ligand that belongs to the ephrin family of proteins. It has a mass of approximately 22 kDa. Ephrin A1 engages in the binding and activation of Eph receptors particularly EphA2 which mediates bidirectional signaling between cells. This protein is widely expressed in various tissues including the adult brain lungs and liver. It plays a significant role in cell-cell communication especially during developmental processes.
Biological function summary

Ephrin A1 contributes to the regulation of cell movement and adhesion. It often forms part of a receptor-ligand complex with Eph receptors on adjacent cells. This interaction controls the guidance of axonal growth angiogenesis and tissue boundary formation. In the nervous system ephrin A1 influences the segregation of synaptic connections playing a role in developing the proper neural circuitry. Its expression patterns suggest its involvement in vascular processes and other critical physiological functions.

Pathways

Ephrin A1 is significantly involved in various signaling pathways that mediate cellular attachment and repulsion features. Notably it participates in the Eph/ephrin signaling and the Rho family GTPase signaling pathways. Through its interaction with the EphA2 receptor ephrin A1 regulates cytoskeletal dynamics and influences both integrin-mediated adhesion and cell migration. These pathways are important for maintaining cellular architecture and orchestrating cellular responses to environmental cues.

Ephrin A1 has been implicated in several pathological conditions notably breast cancer and glioblastoma. It interacts with the EphA2 receptor which is overexpressed in these cancers contributing to tumor development and progression. It is also associated with cancer-related proteins involved in metastatic signaling. Studies show that disrupted ephrin A1/EphA2 interactions can affect tumor angiogenesis and cellular proliferation highlighting its potential as a target for therapeutic intervention in cancer biology.

일반 정보

기능

Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells (PubMed : 17332925, PubMed : 18794797). Involved in angiogenesis, regulating vascular endothelial cell differentiation and migration through activation of EPHA2. Acts as a ligand for EPHA3, inhibiting epithelial-to-mesenchymal transition of cardiac cells and playing a role in heart development (PubMed : 12794130). May also contribute to dendritic spine morphogenesis (By similarity).

서열 유사성

Belongs to the ephrin family.

Post-translational modifications

Undergoes proteolysis by a metalloprotease to give rise to a soluble monomeric form.. N-Glycosylation is required for binding to EPHA2 receptor and inducing its internalization.

제품 프로토콜

타겟 정보

Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells (PubMed : 17332925, PubMed : 18794797). Involved in angiogenesis, regulating vascular endothelial cell differentiation and migration through activation of EPHA2. Acts as a ligand for EPHA3, inhibiting epithelial-to-mesenchymal transition of cardiac cells and playing a role in heart development (PubMed : 12794130). May also contribute to dendritic spine morphogenesis (By similarity).
See full target information EFNA1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com