JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB235877

Recombinant Human Ephrin B1 protein (Fc tag C-Terminus + His tag C-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Ephrin B1 protein (Fc tag C-Terminus + His tag C-Terminus) is a Human Fragment protein, in the 28 to 237 aa range, expressed in Baculovirus infected insect cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

대체 명칭 보기

EFL3, EPLG2, LERK2, EFNB1, Ephrin-B1, EFL-3, ELK ligand, EPH-related receptor tyrosine kinase ligand 2, ELK-L, LERK-2

1 이미지
SDS-PAGE - Recombinant Human Ephrin B1 protein (Fc tag C-Terminus + His tag C-Terminus) (AB235877)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Ephrin B1 protein (Fc tag C-Terminus + His tag C-Terminus) (AB235877)

15% SDS-PADE analysis of 3 μg ab235877.

50-70 kDa (Under reducing conditions)

주요 정보

Purity

>90% SDS-PAGE

Affinity purified

Endotoxin 레벨

< 1 EU/µg

발현 시스템

Baculovirus infected insect cells

Tags

Fc tag C-Terminus His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"ADPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"50.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":237,"aminoAcidStart":28,"nature":"Recombinant","expressionSystem":"Baculovirus infected insect cells","accessionNumber":"P98172","tags":[{"tag":"Fc","terminus":"C-Terminus"},{"tag":"His","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Affinity purification
배송 시 보관 조건
Blue Ice
적절한 단기 보관 기간
1-2 weeks
적절한 단기 보관 조건
+4°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Ephrin-B1 also known as B1 protein or Ephrin-B1 protein is a member of the ephrin family with a mass around 25 kDa. Located on the plasma membrane Ephrin-B1 mainly expresses in the nervous system skeletal system and some epithelial tissues. The protein functions as a ligand for the Eph receptor family which plays a role in cell signaling. Ephrin-B1 interacts with Eph receptors through bi-directional signaling influencing cellular communication and movement.
Biological function summary

Ephrin-B1 is critical for cell positioning and boundary formation. It is part of a transmembrane protein complex influencing cell-to-cell interactions. Through its role in adhesion and repulsion Ephrin-B1 helps coordinate developmental processes such as tissue assembly and organ development. The protein serves essential roles in maintaining cellular architecture ensuring that cells adhere and detach properly during development and wound repair.

Pathways

The ephrin-B1 signaling is important to the Eph receptor pathways particularly the EphB forward and reverse signaling pathways. These pathways are well known for their functions in axon guidance and synaptic plasticity linking Ephrin-B1 with the nervous system development. Related proteins in these pathways include EphB2 and EphB4 which work alongside Ephrin-B1 in regulating the dynamics of these pathways facilitating processes like neurite outgrowth and spine morphogenesis.

Ephrin-B1 is associated with cleft palate and craniofrontonasal syndrome. Mutations or dysregulation in Ephrin-B1 can disrupt normal tissue boundary formation and cell migration leading to such developmental disorders. Abnormal interaction between Ephrin-B1 and related proteins such as EphB2 can affect developmental signaling cascades highlighting the importance of this protein in proper craniofacial and tissue development.

일반 정보

기능

Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development (PubMed : 7973638, PubMed : 8070404). Binding to Eph receptors residing on adjacent cells leads to contact-dependent bidirectional signaling into neighboring cells (PubMed : 7973638, PubMed : 8070404). Shows high affinity for the receptor tyrosine kinase EPHB1/ELK (PubMed : 7973638, PubMed : 8070404). Can also bind EPHB2 and EPHB3 (PubMed : 8070404). Binds to, and induces collapse of, commissural axons/growth cones in vitro (By similarity). May play a role in constraining the orientation of longitudinally projecting axons (By similarity).

서열 유사성

Belongs to the ephrin family.

Post-translational modifications

Inducible phosphorylation of tyrosine residues in the cytoplasmic domain.. Proteolytically processed. The ectodomain is cleaved, probably by a metalloprotease, to produce a membrane-tethered C-terminal fragment. This fragment is then further processed by the gamma-secretase complex to yield a soluble intracellular domain peptide which can translocate to the nucleus. The intracellular domain peptide is highly labile suggesting that it is targeted for degradation by the proteasome.

제품 프로토콜

타겟 정보

Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development (PubMed : 7973638, PubMed : 8070404). Binding to Eph receptors residing on adjacent cells leads to contact-dependent bidirectional signaling into neighboring cells (PubMed : 7973638, PubMed : 8070404). Shows high affinity for the receptor tyrosine kinase EPHB1/ELK (PubMed : 7973638, PubMed : 8070404). Can also bind EPHB2 and EPHB3 (PubMed : 8070404). Binds to, and induces collapse of, commissural axons/growth cones in vitro (By similarity). May play a role in constraining the orientation of longitudinally projecting axons (By similarity).
See full target information EFNB1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com