JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB307190

Recombinant Human ErbB3 / HER3 protein (Fc Chimera) (Active)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human ErbB3 / HER3 protein (Fc Chimera) (Active) is a Human Fragment protein, in the 20 to 643 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC, Mass Spec, FuncS.

대체 명칭 보기

HER3, ERBB3, Receptor tyrosine-protein kinase erbB-3, Proto-oncogene-like protein c-ErbB-3, Tyrosine kinase-type cell surface receptor HER3

4 이미지
Functional Studies - Recombinant Human ErbB3 / HER3 protein (Fc Chimera) (Active) (AB307190)
  • FuncS

Lab

Functional Studies - Recombinant Human ErbB3 / HER3 protein (Fc Chimera) (Active) (AB307190)

Loaded Human ErBB3, Fc Tag on Protein A Biosensor, can bind Human NRG1, His Tag with an affinity constant of 45.2 nM as determined in BLI assay (GatorBio Prime).

Mass Spectrometry - Recombinant Human ErbB3 / HER3 protein (Fc Chimera) (Active) (AB307190)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human ErbB3 / HER3 protein (Fc Chimera) (Active) (AB307190)

Mass determination by ESI-TOF. Predicted MW is 94608.44 Da (+/- 10 Da by ESI-TOF). Observed MW is 94492.70 Da.

SDS-PAGE - Recombinant Human ErbB3 / HER3 protein (Fc Chimera) (Active) (AB307190)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human ErbB3 / HER3 protein (Fc Chimera) (Active) (AB307190)

SDS-page analysis of ab307190

HPLC - Recombinant Human ErbB3 / HER3 protein (Fc Chimera) (Active) (AB307190)
  • HPLC

Supplier Data

HPLC - Recombinant Human ErbB3 / HER3 protein (Fc Chimera) (Active) (AB307190)

HPLC analysis of ab307190

주요 정보

Purity

>95% HPLC

SDS-PAGE >=95%

Endotoxin 레벨

<0.005 EU/µg

발현 시스템

HEK 293 cells

Tags

Fc tag C-Terminus

Applications

Mass Spec, HPLC, SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Loaded Human ErBB3, Fc Tag on Protein A Biosensor, can bind Human NRG1, His Tag with an affinity constant of 45.2 nM as determined in BLI assay (GatorBio Prime).

Accession

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product. Store lyophilized form at room temperature. Reconstitute in phosphate buffered saline, aliquot and store at -80°C for 12 months or +4°C for 1 week. Avoid repeated freeze-thaw.

보관 버퍼

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLT","proteinLength":"Fragment","predictedMolecularWeight":"94.61 kDa","actualMolecularWeight":"94.49 kDa","aminoAcidEnd":643,"aminoAcidStart":20,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P21860","tags":[{"tag":"Fc","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

The ErbB3 protein also known as HER3 is a member of the epidermal growth factor receptor (EGFR) family. It belongs to the ErbB receptor tyrosine kinase family but lacks intrinsic kinase activity. The HER3 protein has a molecular weight of approximately 180 kDa. You will find HER3 expressed in various tissues with high expression in the epithelial tissues where it plays a role in normal cellular processes. HER3 interacts with multiple ligands facilitating cellular communication and growth regulation.
Biological function summary

HER3 is essential for activating important signaling pathways that regulate proliferation differentiation and survival. The ErbB3 protein forms heterodimers with other ErbB family members such as ErbB2 (HER2) which is necessary for its signaling capability. The HER3 protein is abundant in heart and nervous tissues indicating its role in cardiovascular and neurological functions. Its activation modulates gene expression through downstream effectors mediated by dimerization.

Pathways

HER3 plays a pivotal role in the PI3K/Akt and MAPK signaling pathways. These pathways are fundamental in cellular responses like growth and survival. HER3 serves as a major partner for HER2 in these signaling cascades enhancing downstream signaling effects. HER3's connection to these pathways makes it a critical node collaborating closely with proteins such as HER2 and EGFR to maintain efficient communication and function within these networks.

HER3 associates strongly with cancer and cardiovascular diseases. Its overexpression in certain cancers such as breast cancer leads to enhanced tumor growth and resistance to therapy. HER3's relationship with the HER2 protein is especially significant in HER2-positive breast cancer where their interaction drives tumor progression. Additionally alterations in HER3 expression or function impact cardiovascular diseases as it plays a significant role in heart and vascular cell behavior. Recognizing HER3's involvement in these conditions allows for targeted therapeutic approaches and improves disease management strategies.

일반 정보

기능

Tyrosine-protein kinase that plays an essential role as cell surface receptor for neuregulins. Binds to neuregulin-1 (NRG1) and is activated by it; ligand-binding increases phosphorylation on tyrosine residues and promotes its association with the p85 subunit of phosphatidylinositol 3-kinase (PubMed : 20682778). May also be activated by CSPG5 (PubMed : 15358134). Involved in the regulation of myeloid cell differentiation (PubMed : 27416908).

서열 유사성

Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily.

Post-translational modifications

Autophosphorylated (PubMed:20351256). Ligand-binding increases phosphorylation on tyrosine residues and promotes its association with the p85 subunit of phosphatidylinositol 3-kinase (PubMed:20682778).

제품 프로토콜

타겟 정보

Tyrosine-protein kinase that plays an essential role as cell surface receptor for neuregulins. Binds to neuregulin-1 (NRG1) and is activated by it; ligand-binding increases phosphorylation on tyrosine residues and promotes its association with the p85 subunit of phosphatidylinositol 3-kinase (PubMed : 20682778). May also be activated by CSPG5 (PubMed : 15358134). Involved in the regulation of myeloid cell differentiation (PubMed : 27416908).
See full target information ERBB3

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com