JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB196413

Recombinant human EZH1 + EED + SUZ12 + RBBP4 + AEBP2 protein (Active) (His N-Term, DDDDK N-Term)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant human EZH1 + EED + SUZ12 + RBBP4 + AEBP2 protein (Active) (His N-Term, DDDDK N-Term) is a Human Full Length protein, in the 2 to 425 aa range, expressed in Baculovirus infected Sf9 cells, with >79%, suitable for SDS-PAGE, FuncS.

대체 명칭 보기

RBAP48, RBBP4, Histone-binding protein RBBP4, Chromatin assembly factor 1 subunit C, Chromatin assembly factor I p48 subunit, Nucleosome-remodeling factor subunit RBAP48, Retinoblastoma-binding protein 4, Retinoblastoma-binding protein p48, CAF-1 subunit C, CAF-I 48 kDa subunit, CAF-I p48, RBBP-4, CHET9, JJAZ1, KIAA0160, SUZ12, Polycomb protein SUZ12, Chromatin precipitated E2F target 9 protein, Joined to JAZF1 protein, Suppressor of zeste 12 protein homolog, ChET 9 protein, Polycomb protein EED, hEED, Embryonic ectoderm development protein, WD protein associating with integrin cytoplasmic tails 1, WAIT-1, EED, KIAA0388, EZH1, Histone-lysine N-methyltransferase EZH1, ENX-2, Enhancer of zeste homolog 1, Zinc finger protein AEBP2, Adipocyte enhancer-binding protein 2, AE-binding protein 2, AEBP2

2 이미지
Functional Studies - Recombinant human EZH1 + EED + SUZ12 + RBBP4 + AEBP2 protein (Active) (His N-Term, DDDDK N-Term) (AB196413)
  • FuncS

Unknown

Functional Studies - Recombinant human EZH1 + EED + SUZ12 + RBBP4 + AEBP2 protein (Active) (His N-Term, DDDDK N-Term) (AB196413)

Specific activity of ab196413.

SDS-PAGE - Recombinant human EZH1 + EED + SUZ12 + RBBP4 + AEBP2 protein (Active) (His N-Term, DDDDK N-Term) (AB196413)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human EZH1 + EED + SUZ12 + RBBP4 + AEBP2 protein (Active) (His N-Term, DDDDK N-Term) (AB196413)

SDS-PAGE analysis of ab196413.

주요 정보

Purity

>79% SDS-PAGE

Affinity purified.

발현 시스템

Baculovirus infected Sf9 cells

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

50 μl reaction mix (20 mM phosphate pH 7.4, 0.05% Tween-20, 40 μM S-adenosylmethionine, and ab196413 were added to the wells coated with the substrate on a Neutravidin white plate. Incubated for 1 hr. Added antibody against methylated K27 residue of histone H3, incubated 1 hr. Then, added secondary HRP-labeled antibody and incubated 30 min. Finally, added HRP chemiluminescent substrates and read luminescence.

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Preservative: 1.36% Imidazole Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.02% Potassium chloride

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"ADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":425,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q09028","tags":[{"tag":"His","terminus":"N-Terminus"}]},{"linker":null,"sequence":"SEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":441,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"O75530","tags":[{"tag":"DDDDK","terminus":"N-Terminus"}]},{"linker":null,"sequence":"APQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":739,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q15022","tags":[{"tag":"His","terminus":"N-Terminus"}]},{"linker":null,"sequence":"AAAITDMADLEELSRLSPLPPGSPGSAARGRAEPPEEEEEEEEEEEEAEAEAVAALLLNGGSGGGGGGGGGGVGGGEAETMSEPSPESASQAGEDEDEEEDDEEEEDESSSSGGGEEESSAESLVGSSGGSSSDETRSLSPGAASSSSGDGDGKEGLEEPKGPRGSQGGGGGGSSSSSVVSSGGDEGYGTGGGGSSATSGGRRGSLEMSSDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKR","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":503,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q6ZN18","tags":[{"tag":"His","terminus":"N-Terminus"}]},{"linker":null,"sequence":"EIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEWKKLRVQPVQSMKPVSGHPFLKKCTIESIFPGFASQHMLMRSLNTVALVPIMYSWSPLQQNFMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELVDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIFSAIASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGRRRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASPAPPQLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLILKLPTDELMNPSQKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPDRPCDSTCPCIMTQNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVVSCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQAGEELFFDYRYSQADALKYVGIERETDVL","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":747,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"Q92800","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Affinity purification
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
보관 정보
Avoid freeze / thaw cycle
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

The EZH1 EED SUZ12 RBBP4 and AEBP2 proteins form the core of Polycomb Repressive Complex 2 (PRC2) which is an essential multi-subunit protein assembly. The main function of PRC2 lies in its ability to methylate histone H3 on lysine 27 (H3K27me3) an important histone modification promoting chromatin compaction and gene silencing. The molecular weight of each subunit varies with EZH1 around 85 kDa. The PRC2 components such as EZH1 mostly express in tissues where epigenetic regulation is required including embryonic stem cells and various somatic tissues.
Biological function summary

This complex plays a significant role in maintaining transcriptional repression across the genome contributing to cellular identity and stem cell pluripotency. PRC2 including the catalytic subunit EZH1 and its accessory proteins EED SUZ12 RBBP4 and AEBP2 facilitates chromatin remodeling and maintenance of gene silencing by regulating the histone methylation status. This biological mechanism influences differentiation pathways and is important in preserving a balance between cell proliferation and specialization.

Pathways

EZH1 and its associated complex modulate important developmental and signaling pathways such as the Wnt and Notch pathways. PRC2 works closely with other chromatin modifiers and regulators like HDAC1/2 contributing to the fine-tuning of gene expression during development and cellular differentiation. These pathways are integral to the regulation of cell fate decisions and PRC2's activity ensures proper pathway signaling through chromatin-mediated control.

Abnormalities in EZH1 and associated PRC2 components link to certain cancers especially leukemia and breast cancer. Mutations or altered expression levels of PRC2 subunits influence chromatin structure and gene regulation potentially leading to oncogenesis. These components interact with other proteins such as DNMT3A and TET2 which also play roles in epigenetic modifications and cancer development. Understanding the relationship between PRC2 and disease offers potential therapeutic avenues for targeting these pathways in cancer treatment.

일반 정보

기능

Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA (PubMed : 10866654). Component of the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair (PubMed : 8858152). Component of the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression (PubMed : 9150135). Component of the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling (PubMed : 16428440, PubMed : 28977666, PubMed : 39460621). Component of the PRC2 complex, which promotes repression of homeotic genes during development (PubMed : 29499137, PubMed : 31959557). Component of the NURF (nucleosome remodeling factor) complex (PubMed : 14609955, PubMed : 15310751).

서열 유사성

Belongs to the WD repeat RBAP46/RBAP48/MSI1 family.

제품 프로토콜

타겟 정보

Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA (PubMed : 10866654). Component of the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair (PubMed : 8858152). Component of the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression (PubMed : 9150135). Component of the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling (PubMed : 16428440, PubMed : 28977666, PubMed : 39460621). Component of the PRC2 complex, which promotes repression of homeotic genes during development (PubMed : 29499137, PubMed : 31959557). Component of the NURF (nucleosome remodeling factor) complex (PubMed : 14609955, PubMed : 15310751).
See full target information RBBP4

Additional targets

EED,SUZ12,,EZH1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com