JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB132153

Recombinant Human FANCI protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human FANCI protein (GST tag N-Terminus) is a Human Fragment protein, in the 180 to 252 aa range, expressed in Wheat germ, with >80%, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

KIAA1794, FANCI, Fanconi anemia group I protein, Protein FACI

1 이미지
SDS-PAGE - Recombinant Human FANCI protein (GST tag N-Terminus) (AB132153)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human FANCI protein (GST tag N-Terminus) (AB132153)

SDS-PAGE analysis of ab132153 on a 12.5% gel stained with Coomassie Blue.

주요 정보

Purity

>80%

Glutathione Sepharose

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MFKDVPLTAEEVEFVVEKALSMFSKMNLQEIPPLVYQLLVLSSKGSRKSVLEGIIAFFSALDKQHNEEQSGDE","proteinLength":"Fragment","predictedMolecularWeight":"33.77 kDa","actualMolecularWeight":null,"aminoAcidEnd":252,"aminoAcidStart":180,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9NVI1","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Affinity purification GST Tag
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

FANCI also known as Fanconi anemia group I protein is an important player in DNA repair processes. This protein has a molecular mass of approximately 150 kDa. It is ubiquitously expressed with notable levels found in tissues that undergo high rates of cell division. FANCI participates mechanically within the DNA repair mechanism by interacting directly with DNA alongside its partner protein FANCD2 to form a tight complex that recognizes and binds to sites of DNA damage.
Biological function summary

The FANCI protein acts as part of the multiprotein Fanconi anemia (FA) core complex. This complex Functions in the repair of DNA interstrand crosslinks which are severe forms of DNA damage. Successful function of FANCI is important for maintaining genomic stability and subsequently proper cell cycle progression. It partners with proteins including FANCD2 to coordinate the homologous recombination repair process. Defective FANCI leads to disrupted DNA repair resulting in cellular damage and apoptosis.

Pathways

FANCI plays a major role in the Fanconi anemia pathway and the broader DNA damage response system. The FA pathway which involves over 20 proteins forms a network integral in repairing DNA crosslinks. FANCI tightly interacts with proteins like FANCD2 to initiate DNA repair in response to damage. The successful coordination of these proteins ensures the stability of genetic material throughout the cell cycle affecting cell fate decisions such as survival or apoptosis.

FANCI mutations are directly linked to Fanconi anemia a genetic disorder characterized by bone marrow failure and increased cancer risk. Mutations can impair the protein’s function causing defective DNA repair capability. Additionally FANCI's involvement in DNA repair associates it with breast cancer where malfunction or reduced expression of FANCI is observed. The protein interacts with tumor suppressors like BRCA1 and BRCA2 linking it to pathways involved in hereditary breast cancer predisposition.

일반 정보

기능

Plays an essential role in the repair of DNA double-strand breaks by homologous recombination and in the repair of interstrand DNA cross-links (ICLs) by promoting FANCD2 monoubiquitination by FANCL and participating in recruitment to DNA repair sites (PubMed : 17412408, PubMed : 17460694, PubMed : 17452773, PubMed : 19111657, PubMed : 36385258). The FANCI-FANCD2 complex binds and scans double-stranded DNA (dsDNA) for DNA damage; this complex stalls at DNA junctions between double-stranded DNA and single-stranded DNA (PubMed : 19589784). Participates in S phase and G2 phase checkpoint activation upon DNA damage (PubMed : 25862789).

서열 유사성

Belongs to the Fanconi anemia group I protein family.

Post-translational modifications

Monoubiquitinated by FANCL on Lys-523 during S phase and upon genotoxic stress (PubMed:17412408, PubMed:17460694, PubMed:19589784, PubMed:36385258). Deubiquitinated by USP1 as cells enter G2/M, or once DNA repair is completed (PubMed:36385258). Monoubiquitination requires the FANCA-FANCB-FANCC-FANCE-FANCF-FANCG-FANCM complex (PubMed:17412408, PubMed:17460694). Ubiquitination is required for binding to chromatin, DNA repair, and normal cell cycle progression (PubMed:36385258). Monoubiquitination is stimulated by DNA-binding (PubMed:36385258).. Phosphorylated in response to DNA damage by ATM and/or ATR (PubMed:17412408). Phosphorylation of FANCI promotes ubiquitination of FANCD2, which prevents DNA release from the FANCI-FANCD2 complex (By similarity).

Subcellular localisation

Nucleus

제품 프로토콜

타겟 정보

Plays an essential role in the repair of DNA double-strand breaks by homologous recombination and in the repair of interstrand DNA cross-links (ICLs) by promoting FANCD2 monoubiquitination by FANCL and participating in recruitment to DNA repair sites (PubMed : 17412408, PubMed : 17460694, PubMed : 17452773, PubMed : 19111657, PubMed : 36385258). The FANCI-FANCD2 complex binds and scans double-stranded DNA (dsDNA) for DNA damage; this complex stalls at DNA junctions between double-stranded DNA and single-stranded DNA (PubMed : 19589784). Participates in S phase and G2 phase checkpoint activation upon DNA damage (PubMed : 25862789).
See full target information FANCI

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com