JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB113594

Recombinant Human FAT10 protein (His tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human FAT10 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 165 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

대체 명칭 보기

FAT10, UBD, Ubiquitin D, Diubiquitin, Ubiquitin-like protein FAT10

1 이미지
SDS-PAGE - Recombinant Human FAT10 protein (His tag N-Terminus) (AB113594)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human FAT10 protein (His tag N-Terminus) (AB113594)

SDS-PAGE of ab113594 (3µg) under reducing condition and visualized by coomassie blue stain.

주요 정보

Purity

>85% SDS-PAGE

ab113594 was purified using conventional chromatography.

발현 시스템

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 40% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG","proteinLength":"Full Length","predictedMolecularWeight":"20.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":165,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O15205","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 기간
1-2 weeks
적절한 단기 보관 조건
+4°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

FAT10 also known as UBD (Ubiquitin D) is a protein with an approximate mass of 18 kDa. It is a ubiquitin-like modifier involved in post-translational modifications. The protein is expressed in various tissues including the spleen thymus and lymph nodes with elevated levels often detected in cancer cells and tissues responding to proinflammatory cytokines. FAT10 plays a role in signaling for degradation of substrate proteins by the proteasome.
Biological function summary

FAT10 contributes to cellular processes like cell cycle regulation and apoptosis. It forms part of a complex with other ubiquitin-like proteins impacting protein degradation pathways. FAT10's interaction with the proteasome highlights its role in maintaining protein homeostasis and regulating immune response. By tagging proteins for degradation FAT10 influences cellular functions important for adaptation to stress and control of cell proliferation.

Pathways

FAT10 integrates into the NF-kB and TGF-beta pathways. This integration links it to inflammatory responses and tumorigenesis. In the NF-kB pathway FAT10 modulates protein degradation associated with inflammatory signaling and immune regulation. It has connections with other ubiquitin-related proteins such as ubiquitin itself to regulate activities within these pathways impacting cellular responses to external stimuli.

FAT10 shows a significant association with cancer and autoimmune diseases. Its overexpression is noted in various carcinomas including liver and colorectal cancers where it promotes oncogenic pathways and inhibits apoptosis. Additionally in autoimmune conditions such as lupus FAT10's role in regulating immune response becomes pertinent. It often interacts with proteins like p53 in cancer pathologies indicating its involvement in the stabilization and degradation of key regulatory molecules.

일반 정보

기능

Ubiquitin-like protein modifier which can be covalently attached to target proteins and subsequently leads to their degradation by the 26S proteasome, in a NUB1-dependent manner (PubMed : 15831455, PubMed : 16707496, PubMed : 19166848). Conjugation to the target protein is activated by UBA6 via adenylation of its C-terminal glycine (PubMed : 17889673, PubMed : 35970836). Promotes the expression of the proteasome subunit beta type-9 (PSMB9/LMP2). Regulates TNF-induced and LPS-mediated activation of the central mediator of innate immunity NF-kappa-B by promoting TNF-mediated proteasomal degradation of ubiquitinated-I-kappa-B-alpha (PubMed : 19959714). Required for TNF-induced p65 nuclear translocation in renal tubular epithelial cells (RTECs). May be involved in dendritic cell (DC) maturation, the process by which immature dendritic cells differentiate into fully competent antigen-presenting cells that initiate T-cell responses (PubMed : 19028597). Mediates mitotic non-disjunction and chromosome instability, in long-term in vitro culture and cancers, by abbreviating mitotic phase and impairing the kinetochore localization of MAD2L1 during the prometaphase stage of the cell cycle (PubMed : 16495226). May be involved in the formation of aggresomes when proteasome is saturated or impaired (PubMed : 19033385). Mediates apoptosis in a caspase-dependent manner, especially in renal epithelium and tubular cells during renal diseases such as polycystic kidney disease and Human immunodeficiency virus (HIV)-associated nephropathy (HIVAN) (PubMed : 16495380).

서열 유사성

Belongs to the ubiquitin D family.

Post-translational modifications

Can be acetylated.

Subcellular localisation

Nucleus

제품 프로토콜

타겟 정보

Ubiquitin-like protein modifier which can be covalently attached to target proteins and subsequently leads to their degradation by the 26S proteasome, in a NUB1-dependent manner (PubMed : 15831455, PubMed : 16707496, PubMed : 19166848). Conjugation to the target protein is activated by UBA6 via adenylation of its C-terminal glycine (PubMed : 17889673, PubMed : 35970836). Promotes the expression of the proteasome subunit beta type-9 (PSMB9/LMP2). Regulates TNF-induced and LPS-mediated activation of the central mediator of innate immunity NF-kappa-B by promoting TNF-mediated proteasomal degradation of ubiquitinated-I-kappa-B-alpha (PubMed : 19959714). Required for TNF-induced p65 nuclear translocation in renal tubular epithelial cells (RTECs). May be involved in dendritic cell (DC) maturation, the process by which immature dendritic cells differentiate into fully competent antigen-presenting cells that initiate T-cell responses (PubMed : 19028597). Mediates mitotic non-disjunction and chromosome instability, in long-term in vitro culture and cancers, by abbreviating mitotic phase and impairing the kinetochore localization of MAD2L1 during the prometaphase stage of the cell cycle (PubMed : 16495226). May be involved in the formation of aggresomes when proteasome is saturated or impaired (PubMed : 19033385). Mediates apoptosis in a caspase-dependent manner, especially in renal epithelium and tubular cells during renal diseases such as polycystic kidney disease and Human immunodeficiency virus (HIV)-associated nephropathy (HIVAN) (PubMed : 16495380).
See full target information UBD

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com