JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB179489

Recombinant human FGF2 protein (Animal Free)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant human FGF2 protein (Animal Free) is a Human Full Length protein, in the 142 to 288 aa range, expressed in Escherichia coli, with >97%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

대체 명칭 보기

FGFB, FGF2, Fibroblast growth factor 2, FGF-2, Basic fibroblast growth factor, Heparin-binding growth factor 2, bFGF, HBGF-2

1 이미지
Functional Studies (Act) - Recombinant human FGF2 protein (Animal Free) (AB179489)
  • FuncS (Act)

Supplier Data

Functional Studies (Act) - Recombinant human FGF2 protein (Animal Free) (AB179489)

Dose-dependent proliferation of mouse BALB/c 3T3 cells with ab179489. Assays were carried out in triplicate.

주요 정보

Purity

>97% SDS-PAGE

Endotoxin 레벨

< 1 EU/µg

발현 시스템

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

The activity is determined by the dose-dependent proliferation of mouse BALB/c 3T3 cells and is typically less than 1 ng/mL.

Accession

Animal free

Yes

Carrier free

Yes

Species

Human

Reconstitution

Reconstitute at 0.1 mg/mL in water

보관 버퍼

Constituents: 0.14% Sodium phosphate

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS","proteinLength":"Full Length","predictedMolecularWeight":"16.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":288,"aminoAcidStart":142,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P09038","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA)
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

FGF2 also known as FGF-2 or basic fibroblast growth factor is a protein that plays important roles in various cellular processes. It is a member of the fibroblast growth factor family and has a molecular weight of approximately 18 kDa. Scientists find FGF2 protein in many tissues including brain myocardium and bone. The protein can exist in different forms including recombinant variants. It interacts with cell surface receptors to exert its effects significantly influencing cell behavior.
Biological function summary

Various functions characterize FGF2 such as cell proliferation differentiation and migration. It does not act alone but is part of a larger protein complex. This complex includes FGF receptors which help mediate the binding of the FGF2 peptide ensuring proper signaling within the cells. FGF2 is important for development and repair processes making it an essential factor in tissue maintenance and regeneration.

Pathways

FGF2 plays a big role in critical pathways like the MAPK/ERK signaling pathway and PI3K/Akt pathway. These pathways help regulate the processes of cell growth and survival. FGF2 interacts with other protein molecules such as FGFR1 and FGFR2 which serve as receptors to propagate the signaling cascade initiated by FGF2 binding. Its interaction in these pathways underlines its role in modulating important cellular responses.

Scientists connect FGF2 with conditions such as cancer and atherosclerosis. The protein's deregulation may lead to abnormal cell proliferation contributing to tumor growth and vascular diseases. FGF2's interaction with proteins like FGFR1 can influence cancer progression and plaque formation in blood vessels. By understanding FGF2's role in these diseases researchers aim to develop targeted therapies that can potentially alter disease outcomes.

일반 정보

기능

Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4 (PubMed : 8663044). Also acts as an integrin ligand which is required for FGF2 signaling (PubMed : 28302677). Binds to integrin ITGAV : ITGB3 (PubMed : 28302677). Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration (PubMed : 28302677, PubMed : 8663044). Functions as a potent mitogen in vitro (PubMed : 1721615, PubMed : 3732516, PubMed : 3964259). Can induce angiogenesis (PubMed : 23469107, PubMed : 28302677). Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation (PubMed : 29501879).

서열 유사성

Belongs to the heparin-binding growth factors family.

Post-translational modifications

Phosphorylation at Tyr-215 regulates FGF2 unconventional secretion.. Several N-termini starting at positions 94, 125, 126, 132, 143 and 162 have been identified by direct sequencing.

제품 프로토콜

타겟 정보

Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4 (PubMed : 8663044). Also acts as an integrin ligand which is required for FGF2 signaling (PubMed : 28302677). Binds to integrin ITGAV : ITGB3 (PubMed : 28302677). Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration (PubMed : 28302677, PubMed : 8663044). Functions as a potent mitogen in vitro (PubMed : 1721615, PubMed : 3732516, PubMed : 3964259). Can induce angiogenesis (PubMed : 23469107, PubMed : 28302677). Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation (PubMed : 29501879).
See full target information FGF2

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com