JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB209886

Recombinant Human Fibronectin type III EDB protein

Recombinant Human Fibronectin type III EDB 단백질

Be the first to review this product! 리뷰 제출

|

(1 출판물)

Recombinant Human Fibronectin type III EDB protein is a Human Fragment protein, in the 1244 to 1377 aa range with >90% purity and suitable for SDS-PAGE and Functional studies. The predicted molecular weight of ab209886 protein is 17.6 kDa.

- Save time and ensure accurate results - use our fibronectin type III (FN3) EDB protein as a control

대체 명칭 보기

FN, FN1, Fibronectin, Cold-insoluble globulin, CIG

1 이미지
SDS-PAGE - Recombinant Human Fibronectin type III EDB protein (AB209886)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Fibronectin type III EDB protein (AB209886)

SDS PAGE analysis of ab209886, using BSA as a reference control protein. 4-20% gradient gel was used.

Lane 1 : 10μg BSA

Lane 2 : 5μg BSA

Lane 3 : 1μg BSA

Lane 4 : 10μl ab209886

Lane 5 : 5μl ab209886

Lane 6 : 1μl ab209886

주요 정보

Purity

>90% SDS-PAGE

ab209886 was sterile-filtered.

발현 시스템

Escherichia coli

Tags

His-T7 tag N-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.32% Tris HCl

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>This antibody may be used for in vitro FN-III EDB domain mediated human endothelial cell or cancer stroma cell differentiation / migration regulations study with this protein as either soluble factor or coating matrix protein, for in vitro protein-protein interaction mapping and as antigen for specific antibody production.</p>" } } }

제품 세부 정보

The FN3 EDB ab209886 was expressed in E.coli as inclusion bodies. The final product was refolded using a unique "temperature shift inclusion body refolding" technology and chromatographically purified.

Ensure the validity of your result using our recombinant human fibronectin type III (FN3) EDB protein ab155639 as a positive control in SDS-PAGE.

ab155639 can be used for the following assays:
1. In vitro FN-III EDB domain mediated human endothelial cell or cancer stroma cell differentiation / migration regulations study with this protein as either soluble factor or coating matrix protein.
2. In vitro protein-protein interaction mapping.

Function
Extracellular matrix protein fibronectin (FN) plays an important role in cell adhesion. FN contains FN type I, II and III domains. The FN III repeat is generally about 90 amino acid long and to be composed of seven b-strands, forming two antiparallel b-sheets. In the C-terminal of human fibronectin region, there are 16 FN-III repeat domains. FN III domain derived proteins have been demonstrated to bind various proteins with high affinity.
The alternatively-spliced extra-domain B (EDB) of fibronectin represents one of the best characterized markers of angiogenesis. This domain of 91-aminoacids is completely identical between mouse and man, is virtually absent in normal adult tissues (exception made for the endometrium in the proliferative phase and some vessels of the ovaries), but is strongly expressed in most aggressive solid cancer types, with a prominent vascular and/or stromal pattern of expression.

Check out our protein gel staining guide for SDS-PAGE here

서열 정보

[{"linker":null,"sequence":"MASMTGGQQMGRGHHHHHHGNLYFQGGEFNVSVYTVKDDKESVPISDTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVT","proteinLength":"Fragment","predictedMolecularWeight":"17.62 kDa","actualMolecularWeight":null,"aminoAcidEnd":1377,"aminoAcidStart":1244,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P02751","tags":[{"tag":"His-T7","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
False

일반 정보

기능

Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin (PubMed : 3024962, PubMed : 3593230, PubMed : 3900070, PubMed : 7989369). Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape (PubMed : 3024962, PubMed : 3593230, PubMed : 3900070, PubMed : 7989369). Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization (By similarity). Participates in the regulation of type I collagen deposition by osteoblasts (By similarity). Acts as a ligand for the LILRB4 receptor, inhibiting FCGR1A/CD64-mediated monocyte activation (PubMed : 34089617).. Anastellin. Binds fibronectin and induces fibril formation. This fibronectin polymer, named superfibronectin, exhibits enhanced adhesive properties. Both anastellin and superfibronectin inhibit tumor growth, angiogenesis and metastasis. Anastellin activates p38 MAPK and inhibits lysophospholipid signaling.. Secreted by contracting muscle, induces liver autophagy, a degradative pathway for nutrient mobilization and damage removal, and systemic insulin sensitization via hepatic ITGA5 : ITGB1 integrin receptor signaling.

Post-translational modifications

Sulfated.. It is not known whether both or only one of Thr-2155 and Thr-2156 are/is glycosylated.. Forms covalent cross-links mediated by a transglutaminase, such as F13A or TGM2, between a glutamine and the epsilon-amino group of a lysine residue, forming homopolymers and heteropolymers (e.g. fibrinogen-fibronectin, collagen-fibronectin heteropolymers).. Phosphorylated by FAM20C in the extracellular medium.. Proteolytic processing produces the C-terminal NC1 peptide, anastellin.. Some lysine residues are oxidized to allysine by LOXL3, promoting fibronectin activation and matrix formation.. Serotonylated on Gln residues by TGM2 in response to hypoxia.

제품 프로토콜

타겟 정보

Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin (PubMed : 3024962, PubMed : 3593230, PubMed : 3900070, PubMed : 7989369). Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape (PubMed : 3024962, PubMed : 3593230, PubMed : 3900070, PubMed : 7989369). Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization (By similarity). Participates in the regulation of type I collagen deposition by osteoblasts (By similarity). Acts as a ligand for the LILRB4 receptor, inhibiting FCGR1A/CD64-mediated monocyte activation (PubMed : 34089617).. Anastellin. Binds fibronectin and induces fibril formation. This fibronectin polymer, named superfibronectin, exhibits enhanced adhesive properties. Both anastellin and superfibronectin inhibit tumor growth, angiogenesis and metastasis. Anastellin activates p38 MAPK and inhibits lysophospholipid signaling.. Secreted by contracting muscle, induces liver autophagy, a degradative pathway for nutrient mobilization and damage removal, and systemic insulin sensitization via hepatic ITGA5 : ITGB1 integrin receptor signaling.
See full target information FN1

제품이 사용된 논문 (1)

Recent publications for all applications. Explore the 전체 목록 and refine your search

Nature communications 13:6178 PubMed36261433

2022

Helical ultrastructure of the metalloprotease meprin α in complex with a small molecule inhibitor.

Applications

Unspecified application

Species

Unspecified reactive species

Charles Bayly-Jones,Christopher J Lupton,Claudia Fritz,Hariprasad Venugopal,Daniel Ramsbeck,Michael Wermann,Christian Jäger,Alex de Marco,Stephan Schilling,Dagmar Schlenzig,James C Whisstock
제품이 사용된 논문 모두 보기

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com