JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152840

Recombinant Human FXR1 protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human FXR1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 121 to 220 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

RNA-binding protein FXR1, FMR1 autosomal homolog 1, hFXR1p, FXR1

1 이미지
SDS-PAGE - Recombinant Human FXR1 protein (GST tag N-Terminus) (AB152840)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human FXR1 protein (GST tag N-Terminus) (AB152840)

12.5% SDS-PAGE analysis of ab152840 stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"VKKNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLMSRNEEATKHLECTKQLAAAFH","proteinLength":"Fragment","predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":220,"aminoAcidStart":121,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P51114","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

The FXR1 protein also known as Fragile X Mental Retardation Syndrome-related Protein 1 weighs approximately 80 kDa and is expressed in various tissues including the brain heart and the skeletal muscles. It belongs to the family of RNA-binding proteins that also includes FMR1 and FXR2. Mechanically FXR1 interacts with mRNA participating in the regulation of its stability and translation. This regulation allows cells to control protein synthesis important for many cellular processes.
Biological function summary

FXR1 is involved in the post-transcriptional regulation of gene expression important for normal cell function and development. It forms a complex with FMRP playing an important role in the transport and translation of specific subsets of mRNAs in neurons. This interaction suggests it contributes significantly to the synaptic plasticity mechanisms influencing learning and memory. Moreover FXR1 also seems to have functions in cell proliferation and muscle differentiation.

Pathways

FXR1 participates in key regulatory pathways of protein synthesis and neuronal communication. It is significant in the mTOR signaling pathway where it potentially interacts with other proteins like FXR2 and FMR1 to modulate translational control. FXR1's involvement in this pathway suggests a role in cellular growth and neuron-specific processes affecting how cells respond to various growth signals by altering protein synthesis rates.

FXR1 links to psychiatric disorders including schizophrenia and bipolar disorder. Gene dysregulation in FXR1 may disrupt normal synaptic functioning contributing to the pathophysiology of these conditions. In muscular dystrophies altered FXR1 expression has been reported associating it with muscle tissue protein dynamics along with FMR1 influencing muscle regeneration and repair mechanisms. These associations highlight FXR1’s potential as a therapeutic target in neurodevelopmental and muscle-related diseases.

일반 정보

기능

mRNA-binding protein that acts as a regulator of mRNAs translation and/or stability, and which is required for various processes, such as neurogenesis, muscle development and spermatogenesis (PubMed : 17382880, PubMed : 20417602, PubMed : 30067974, PubMed : 34731628, PubMed : 35989368, PubMed : 36306353). Specifically binds to AU-rich elements (AREs) in the 3'-UTR of target mRNAs (PubMed : 17382880, PubMed : 34731628). Promotes formation of some phase-separated membraneless compartment by undergoing liquid-liquid phase separation upon binding to AREs-containing mRNAs, leading to assemble mRNAs into cytoplasmic ribonucleoprotein granules that concentrate mRNAs with associated regulatory factors (By similarity). Required to activate translation of stored mRNAs during late spermatogenesis : acts by undergoing liquid-liquid phase separation to assemble target mRNAs into cytoplasmic ribonucleoprotein granules that recruit translation initiation factor EIF4G3 to activate translation of stored mRNAs in late spermatids (By similarity). Promotes translation of MYC transcripts by recruiting the eIF4F complex to the translation start site (PubMed : 34731628). Acts as a negative regulator of inflammation in response to IL19 by promoting destabilization of pro-inflammatory transcripts (PubMed : 30067974). Also acts as an inhibitor of inflammation by binding to TNF mRNA, decreasing TNF protein production (By similarity). Acts as a negative regulator of AMPA receptor GRIA2/GluA2 synthesis during long-lasting synaptic potentiation of hippocampal neurons by binding to GRIA2/GluA2 mRNA, thereby inhibiting its translation (By similarity). Regulates proliferation of adult neural stem cells by binding to CDKN1A mRNA and promoting its expression (By similarity). Acts as a regulator of sleep and synaptic homeostasis by regulating translation of transcripts in neurons (By similarity). Required for embryonic and postnatal development of muscle tissue by undergoing liquid-liquid phase separation to assemble target mRNAs into cytoplasmic ribonucleoprotein granules (PubMed : 30770808). Involved in the nuclear pore complex localization to the nuclear envelope by preventing cytoplasmic aggregation of nucleoporins : acts by preventing ectopic phase separation of nucleoporins in the cytoplasm via a microtubule-dependent mechanism (PubMed : 32706158). Plays a role in the stabilization of PKP2 mRNA and therefore protein abundance, via its interaction with PKP3 (PubMed : 25225333). May also do the same for PKP2, PKP3 and DSP via its interaction with PKP1 (PubMed : 25225333). Forms a cytoplasmic messenger ribonucleoprotein (mRNP) network by packaging long mRNAs, serving as a scaffold that recruits proteins and signaling molecules. This network facilitates signaling reactions by maintaining proximity between kinases and substrates, crucial for processes like actomyosin reorganization (PubMed : 39106863).

서열 유사성

Belongs to the FMR1 family.

Post-translational modifications

Phosphorylation at Ser-420 by PAK1 promotes its relocalization to stress granules and activity (PubMed:20417602). Phosphorylated by MAPK1/ERK2, promoting subsequent phosphorylation by GSK3B (By similarity). Phosphorylated by GSK3B, promoting ubiquitination and degradation by the proteasome (By similarity).. Ubiquitinated by the SCF(FBXO4) complex, leading to its degradation by the proteasome: ubiquitination by the SCF(FBXO4) complex takes place following phosphorylation by GSK3B (PubMed:29142209). Ubiquitinated and degraded in a GSK3B-dependent manner in during both scaling and sleep deprivation (By similarity). Ubiquitinated via 'Lys-63'-linked ubiquitin, leading to its degradation: interaction with CEP63 inhibits 'Lys-63'-linked ubiquitination (PubMed:35989368).

제품 프로토콜

타겟 정보

mRNA-binding protein that acts as a regulator of mRNAs translation and/or stability, and which is required for various processes, such as neurogenesis, muscle development and spermatogenesis (PubMed : 17382880, PubMed : 20417602, PubMed : 30067974, PubMed : 34731628, PubMed : 35989368, PubMed : 36306353). Specifically binds to AU-rich elements (AREs) in the 3'-UTR of target mRNAs (PubMed : 17382880, PubMed : 34731628). Promotes formation of some phase-separated membraneless compartment by undergoing liquid-liquid phase separation upon binding to AREs-containing mRNAs, leading to assemble mRNAs into cytoplasmic ribonucleoprotein granules that concentrate mRNAs with associated regulatory factors (By similarity). Required to activate translation of stored mRNAs during late spermatogenesis : acts by undergoing liquid-liquid phase separation to assemble target mRNAs into cytoplasmic ribonucleoprotein granules that recruit translation initiation factor EIF4G3 to activate translation of stored mRNAs in late spermatids (By similarity). Promotes translation of MYC transcripts by recruiting the eIF4F complex to the translation start site (PubMed : 34731628). Acts as a negative regulator of inflammation in response to IL19 by promoting destabilization of pro-inflammatory transcripts (PubMed : 30067974). Also acts as an inhibitor of inflammation by binding to TNF mRNA, decreasing TNF protein production (By similarity). Acts as a negative regulator of AMPA receptor GRIA2/GluA2 synthesis during long-lasting synaptic potentiation of hippocampal neurons by binding to GRIA2/GluA2 mRNA, thereby inhibiting its translation (By similarity). Regulates proliferation of adult neural stem cells by binding to CDKN1A mRNA and promoting its expression (By similarity). Acts as a regulator of sleep and synaptic homeostasis by regulating translation of transcripts in neurons (By similarity). Required for embryonic and postnatal development of muscle tissue by undergoing liquid-liquid phase separation to assemble target mRNAs into cytoplasmic ribonucleoprotein granules (PubMed : 30770808). Involved in the nuclear pore complex localization to the nuclear envelope by preventing cytoplasmic aggregation of nucleoporins : acts by preventing ectopic phase separation of nucleoporins in the cytoplasm via a microtubule-dependent mechanism (PubMed : 32706158). Plays a role in the stabilization of PKP2 mRNA and therefore protein abundance, via its interaction with PKP3 (PubMed : 25225333). May also do the same for PKP2, PKP3 and DSP via its interaction with PKP1 (PubMed : 25225333). Forms a cytoplasmic messenger ribonucleoprotein (mRNP) network by packaging long mRNAs, serving as a scaffold that recruits proteins and signaling molecules. This network facilitates signaling reactions by maintaining proximity between kinases and substrates, crucial for processes like actomyosin reorganization (PubMed : 39106863).
See full target information Fragile X mental retardation syndrome-related protein 1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com