JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB214991

Recombinant human galectin 9/Gal-9 protein (Fc Chimera Active)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant human galectin 9/Gal-9 protein (Fc Chimera Active) is a Human Full Length protein, in the 2 to 323 aa range, expressed in HEK 293 cells, with >95%, < 5 EU/mg endotoxin level, suitable for SDS-PAGE, FuncS.

주요 정보

Purity

>95% SDS-PAGE

Endotoxin 레벨

< 5 EU/mg

발현 시스템

HEK 293 cells

Tags

Human IgG1 Fc tag N-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Measured by its binding ability in a functional ELISA.

Accession

O00182-2

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in 50 µL of water

보관 버퍼

Constituents: PBS

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

Previously labelled as galectin 9.

서열 정보

[{"linker":null,"sequence":"AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT","proteinLength":"Full Length","predictedMolecularWeight":"70 kDa","actualMolecularWeight":null,"aminoAcidEnd":323,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"O00182","tags":[{"tag":"Human IgG1 Fc","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Galectin-9 also known as Gal-9 or LGALS9 is a β-galactoside-binding lectin with a molecular mass of around 40 kDa. It shows expression in various tissues including the thymus spleen and liver. The galectin-9 protein is involved in cell-cell and cell-matrix interactions where it binds to glycoproteins and glycolipids. Researchers commonly use methods like Galectin-9 ELISA to measure its levels in different biological samples.
Biological function summary

Galectins like galectin-9 play essential roles in regulating diverse immune responses. Galectin-9 acts within the immune system by modulating inflammation and apoptosis. It acts as both a pro-apoptotic factor for T cells and a protein mediator in innate immune functions. Galectin-9 proteins can form complexes with other lectins and cell surface receptors contributing to cellular signaling processes.

Pathways

Galectin-9 is integral to the immune system's functional networks. It participates in the T-cell regulation pathways and the innate immunity pathways. In these pathways it interacts with other proteins like TIM-3 which mediates T-cell apoptosis and contributes to immune tolerance. These interaction networks play important roles in maintaining the body's immune homeostasis.

Galectin-9 has associations with autoimmune diseases and cancer. Its regulatory effects on T cells connect it to autoimmune conditions where abnormal T-cell activation occurs. In cancer the alteration in galectin-9 expression levels affects tumor immunity. The interaction of galectin-9 with other proteins like TIM-3 is important in cancer progression making it a target of interest for therapeutic interventions.

일반 정보

기능

Binds galactosides (PubMed : 18005988). Has high affinity for the Forssman pentasaccharide (PubMed : 18005988). Ligand for HAVCR2/TIM3 (PubMed : 16286920). Binding to HAVCR2 induces T-helper type 1 lymphocyte (Th1) death (PubMed : 16286920). Also stimulates bactericidal activity in infected macrophages by causing macrophage activation and IL1B secretion which restricts intracellular bacterial growth (By similarity). Ligand for P4HB; the interaction retains P4HB at the cell surface of Th2 T-helper cells, increasing disulfide reductase activity at the plasma membrane, altering the plasma membrane redox state and enhancing cell migration (PubMed : 21670307). Ligand for CD44; the interaction enhances binding of SMAD3 to the FOXP3 promoter, leading to up-regulation of FOXP3 expression and increased induced regulatory T (iTreg) cell stability and suppressive function (By similarity). Promotes ability of mesenchymal stromal cells to suppress T-cell proliferation (PubMed : 23817958). Expands regulatory T-cells and induces cytotoxic T-cell apoptosis following virus infection (PubMed : 20209097). Activates ERK1/2 phosphorylation inducing cytokine (IL-6, IL-8, IL-12) and chemokine (CCL2) production in mast and dendritic cells (PubMed : 16116184, PubMed : 24465902). Inhibits degranulation and induces apoptosis of mast cells (PubMed : 24465902). Induces maturation and migration of dendritic cells (PubMed : 16116184, PubMed : 25754930). Inhibits natural killer (NK) cell function (PubMed : 23408620). Can transform NK cell phenotype from peripheral to decidual during pregnancy (PubMed : 25578313). Astrocyte derived galectin-9 enhances microglial TNF production (By similarity). May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. May provide the molecular basis for urate flux across cell membranes, allowing urate that is formed during purine metabolism to efflux from cells and serving as an electrogenic transporter that plays an important role in renal and gastrointestinal urate excretion (By similarity). Highly selective to the anion urate (By similarity).. Isoform 2. Acts as an eosinophil chemoattractant (PubMed : 9642261). It also inhibits angiogenesis (PubMed : 24333696). Suppresses IFNG production by natural killer cells (By similarity).

Subcellular localisation

Nucleus

제품 프로토콜

타겟 정보

Binds galactosides (PubMed : 18005988). Has high affinity for the Forssman pentasaccharide (PubMed : 18005988). Ligand for HAVCR2/TIM3 (PubMed : 16286920). Binding to HAVCR2 induces T-helper type 1 lymphocyte (Th1) death (PubMed : 16286920). Also stimulates bactericidal activity in infected macrophages by causing macrophage activation and IL1B secretion which restricts intracellular bacterial growth (By similarity). Ligand for P4HB; the interaction retains P4HB at the cell surface of Th2 T-helper cells, increasing disulfide reductase activity at the plasma membrane, altering the plasma membrane redox state and enhancing cell migration (PubMed : 21670307). Ligand for CD44; the interaction enhances binding of SMAD3 to the FOXP3 promoter, leading to up-regulation of FOXP3 expression and increased induced regulatory T (iTreg) cell stability and suppressive function (By similarity). Promotes ability of mesenchymal stromal cells to suppress T-cell proliferation (PubMed : 23817958). Expands regulatory T-cells and induces cytotoxic T-cell apoptosis following virus infection (PubMed : 20209097). Activates ERK1/2 phosphorylation inducing cytokine (IL-6, IL-8, IL-12) and chemokine (CCL2) production in mast and dendritic cells (PubMed : 16116184, PubMed : 24465902). Inhibits degranulation and induces apoptosis of mast cells (PubMed : 24465902). Induces maturation and migration of dendritic cells (PubMed : 16116184, PubMed : 25754930). Inhibits natural killer (NK) cell function (PubMed : 23408620). Can transform NK cell phenotype from peripheral to decidual during pregnancy (PubMed : 25578313). Astrocyte derived galectin-9 enhances microglial TNF production (By similarity). May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. May provide the molecular basis for urate flux across cell membranes, allowing urate that is formed during purine metabolism to efflux from cells and serving as an electrogenic transporter that plays an important role in renal and gastrointestinal urate excretion (By similarity). Highly selective to the anion urate (By similarity).. Isoform 2. Acts as an eosinophil chemoattractant (PubMed : 9642261). It also inhibits angiogenesis (PubMed : 24333696). Suppresses IFNG production by natural killer cells (By similarity).
See full target information LGALS9

대체 명칭 보기

Galectin-9, Gal-9, Ecalectin, Tumor antigen HOM-HD-21, LGALS9

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com