JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB86447

Recombinant Human Geminin protein (His tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(1 출판물)

Recombinant Human Geminin protein (His tag N-Terminus) is a Human Full Length protein, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.
1 이미지
SDS-PAGE - Recombinant Human Geminin protein (His tag N-Terminus) (AB86447)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Geminin protein (His tag N-Terminus) (AB86447)

15% SDS-PAGE showing ab86447.

주요 정보

Purity

>85% SDS-PAGE

ab86447 is purified using conventional chromatography techniques.

발현 시스템

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O75496-1

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O75496","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Geminin also referred to as GMNN is a protein that regulates DNA replication. It has approximately 25 kDa mass. Geminin inhibits DNA replication by preventing the loading of the mini-chromosome maintenance complex onto DNA during the cell cycle. This function ensures that DNA replication takes place only once per cell cycle. Geminin expresses mainly in tissues with high proliferative activity such as the developing nervous system and hematopoietic cells. Its interaction with other proteins plays a significant role in controlling cell cycle progression.
Biological function summary

In a cellular context Geminin forms part of a complex with the nuclear protein Cdt1. This complex is essential in the regulation of the cell cycle's S phase. Geminin's function restricts DNA replication by binding to Cdt1 and stopping its activity which is necessary during the G1/S phase transition. By doing so it preserves the integrity of genetic information and prevents re-replication. Geminin's inhibition remains strict until it is degraded during mitosis allowing Cdt1 to resume its function in the following cell cycle.

Pathways

The regulation of Geminin is important to maintaining proper DNA replication and cell cycle integrity. Geminin plays a role in the cell cycle control pathway particularly during the G1 to S phase transition. Additionally it interfaces with other proteins like Paxillin which is involved in cell adhesion and movement. Although not directly linked in a pathway Paxillin's role in regulating cellular dynamics can influence cell cycle processes in which Geminin is involved. Geminin also serves as a K blocker relevant in maintaining genetic stability.

Aberrations in Geminin activity can lead to severe conditions such as cancer. Its overexpression or misregulation has a link to various tumor types due to its effect on uncontrolled cell proliferation. Geminin's interaction with proteins like Paxillin and Cyclin-dependent kinases also relates to cancer progression as these interactions may involve changes in cellular adhesion and cycle checkpoints. Therefore understanding Geminin's role offers valuable insight for potential therapeutic targets in oncology.

일반 정보

기능

Inhibits DNA replication by preventing the incorporation of MCM complex into pre-replication complex (pre-RC) (PubMed : 14993212, PubMed : 20129055, PubMed : 24064211, PubMed : 9635433). It is degraded during the mitotic phase of the cell cycle (PubMed : 14993212, PubMed : 24064211, PubMed : 9635433). Its destruction at the metaphase-anaphase transition permits replication in the succeeding cell cycle (PubMed : 14993212, PubMed : 24064211, PubMed : 9635433). Inhibits histone acetyltransferase activity of KAT7/HBO1 in a CDT1-dependent manner, inhibiting histone H4 acetylation and DNA replication licensing (PubMed : 20129055). Inhibits the transcriptional activity of a subset of Hox proteins, enrolling them in cell proliferative control (PubMed : 22615398).

서열 유사성

Belongs to the geminin family.

Post-translational modifications

Phosphorylated during mitosis. Phosphorylation at Ser-184 by CK2 results in enhanced binding to Hox proteins and more potent inhibitory effect on Hox transcriptional activity.

Subcellular localisation

Nucleus

제품 프로토콜

타겟 정보

Inhibits DNA replication by preventing the incorporation of MCM complex into pre-replication complex (pre-RC) (PubMed : 14993212, PubMed : 20129055, PubMed : 24064211, PubMed : 9635433). It is degraded during the mitotic phase of the cell cycle (PubMed : 14993212, PubMed : 24064211, PubMed : 9635433). Its destruction at the metaphase-anaphase transition permits replication in the succeeding cell cycle (PubMed : 14993212, PubMed : 24064211, PubMed : 9635433). Inhibits histone acetyltransferase activity of KAT7/HBO1 in a CDT1-dependent manner, inhibiting histone H4 acetylation and DNA replication licensing (PubMed : 20129055). Inhibits the transcriptional activity of a subset of Hox proteins, enrolling them in cell proliferative control (PubMed : 22615398).
See full target information GMNN

대체 명칭 보기

Geminin, GMNN

제품이 사용된 논문 (1)

Recent publications for all applications. Explore the 전체 목록 and refine your search

Nature 558:313-317 PubMed29875408

2018

EMI1 switches from being a substrate to an inhibitor of APC/C to start the cell cycle.

Applications

Unspecified application

Species

Unspecified reactive species

Steven D Cappell,Kevin G Mark,Damien Garbett,Lindsey R Pack,Michael Rape,Tobias Meyer
제품이 사용된 논문 모두 보기

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com