JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB235719

Recombinant Human Oxyntomodulin (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Oxyntomodulin (GST tag N-Terminus) is a Human Fragment protein, in the 53 to 89 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.
1 이미지
SDS-PAGE - Recombinant Human Oxyntomodulin (GST tag N-Terminus) (AB235719)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Oxyntomodulin (GST tag N-Terminus) (AB235719)

(Tris-glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel of ab235719.

주요 정보

Purity

>85% SDS-PAGE

발현 시스템

Escherichia coli

Tags

GST tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P01275-1

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA","proteinLength":"Fragment","predictedMolecularWeight":"30.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":89,"aminoAcidStart":53,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P01275","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
보관 정보
Avoid freeze / thaw cycle
False

일반 정보

기능

Glucagon. Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes. Binds to and activates the glucagon receptor GCGR, which couples to the G(s) G protein and elevates intracellular cAMP, triggering downstream metabolic responses (PubMed : 32193322).. Glucagon-like peptide 1. Potent stimulator of glucose-dependent insulin release (PubMed : 22037645, PubMed : 40446798). Also stimulates insulin release in response to IL6 (PubMed : 22037645). Plays important roles on gastric motility and the suppression of plasma glucagon levels (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). Has growth-promoting activities on intestinal epithelium (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferation (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). Inhibits beta cell apoptosis (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744).. Glucagon-like peptide 2. Stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability.. Oxyntomodulin. Significantly reduces food intake. Inhibits gastric emptying in humans. Suppression of gastric emptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness.. Glicentin. May modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life.

서열 유사성

Belongs to the glucagon family.

Post-translational modifications

Proglucagon is post-translationally processed in a tissue-specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by post-translational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas.

제품 프로토콜

타겟 정보

Glucagon. Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes. Binds to and activates the glucagon receptor GCGR, which couples to the G(s) G protein and elevates intracellular cAMP, triggering downstream metabolic responses (PubMed : 32193322).. Glucagon-like peptide 1. Potent stimulator of glucose-dependent insulin release (PubMed : 22037645, PubMed : 40446798). Also stimulates insulin release in response to IL6 (PubMed : 22037645). Plays important roles on gastric motility and the suppression of plasma glucagon levels (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). Has growth-promoting activities on intestinal epithelium (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferation (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). Inhibits beta cell apoptosis (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744).. Glucagon-like peptide 2. Stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability.. Oxyntomodulin. Significantly reduces food intake. Inhibits gastric emptying in humans. Suppression of gastric emptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness.. Glicentin. May modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life.
See full target information Oxyntomodulin

대체 명칭 보기

Pro-glucagon

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com