JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114330

Recombinant Human Glycophorin A protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Glycophorin A protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 150 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

CD235a, GPA, MNS, GYPA, Glycophorin-A, MN sialoglycoprotein, PAS-2, Sialoglycoprotein alpha

1 이미지
SDS-PAGE - Recombinant Human Glycophorin A protein (GST tag N-Terminus) (AB114330)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Glycophorin A protein (GST tag N-Terminus) (AB114330)

ab114330 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, WB, ELISA

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(for recombinant protein).</p>" } } }

서열 정보

[{"linker":null,"sequence":"MYGKIIFVLLLSAIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ","proteinLength":"Full Length","predictedMolecularWeight":"42.57 kDa","actualMolecularWeight":null,"aminoAcidEnd":150,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P02724","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Glycophorin A also known as CD235a is a major glycoprotein of red blood cell membranes with a mass around 31 kDa. It is importantly expressed on the surface of erythrocytes. Glycophorin A plays an important role in maintaining cell membrane integrity and is associated with various antigenic sites which are important for compatibility testing. Researchers often detect Glycophorin A using antibodies such as Glycophorin A APC or Glycophorin A FITC in flow cytometry studies due to its distinct expression on red blood cells.
Biological function summary

Glycophorin A interacts with other membrane proteins to form part of the membrane's skeletal protein network. This network stabilizes the erythrocyte structure and contributes to its flexibility essential for passing through narrow capillaries. Glycophorin A does not form part of any large multiprotein complex but does interact with other glycophorins such as Glycophorin B. These interactions help to form the MN and Ss blood group antigens.

Pathways

Glycophorin A is involved in several pathways including the erythrocyte development and lipid raft pathways. These pathways are important for cell signaling and membrane transport processes. Glycophorin A's role in erythrocyte development is connected to protein 4.1R which links the membrane to the underlying cytoskeleton influencing red blood cell shape and stability. Additionally its role in lipid raft-mediated signaling intersects with proteins involved in immune response regulation.

Glycophorin A has associations with several conditions including malaria and hereditary spherocytosis. The interaction between Plasmodium falciparum and Glycophorin A contributes to the parasite's ability to invade erythrocytes indicating its relevance in malaria research. Additionally abnormalities with Glycophorin A expression or structure can lead to hereditary spherocytosis often related to a disruption in its interaction with ankyrin another structural protein. Understanding these associations helps elucidate the pathological mechanisms and potential therapeutic targets for these diseases.

일반 정보

기능

Component of the ankyrin-1 complex, a multiprotein complex involved in the stability and shape of the erythrocyte membrane (PubMed : 35835865). Glycophorin A is the major intrinsic membrane protein of the erythrocyte. The N-terminal glycosylated segment, which lies outside the erythrocyte membrane, has MN blood group receptors. Appears to be important for the function of SLC4A1 and is required for high activity of SLC4A1. May be involved in translocation of SLC4A1 to the plasma membrane.. (Microbial infection) Appears to be a receptor for Hepatitis A virus (HAV).. (Microbial infection) Receptor for P.falciparum erythrocyte-binding antigen 175 (EBA-175); binding of EBA-175 is dependent on sialic acid residues of the O-linked glycans.

서열 유사성

Belongs to the glycophorin A family.

Post-translational modifications

The major O-linked glycan are NeuAc-alpha-(2-3)-Gal-beta-(1-3)-[NeuAc-alpha-(2-6)]-GalNAcOH (about 78 %) and NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH (17 %). Minor O-glycans (5 %) include NeuAc-alpha-(2-3)-Gal-beta-(1-3)-[NeuAc-alpha-(2-6)]-GalNAcOH NeuAc-alpha-(2-8)-NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH. About 1% of all O-linked glycans carry blood group A, B and H determinants. They derive from a type-2 precursor core structure, Gal-beta-(1,3)-GlcNAc-beta-1-R, and the antigens are synthesized by addition of fucose (H antigen-specific) and then N-acetylgalactosamine (A antigen-specific) or galactose (B antigen-specific). Specifically O-linked-glycans are NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH-(6-1)-GlcNAc-beta-(4-1)-[Fuc-alpha-(1-2)]-Gal-beta-(3-1)-GalNAc-alpha (about 1%, B antigen-specific) and NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH-(6-1)-GlcNAc-beta-(4-1)-[Fuc-alpha-(1-2)]-Gal-beta (1 %, O antigen-, A antigen- and B antigen-specific).

제품 프로토콜

타겟 정보

Component of the ankyrin-1 complex, a multiprotein complex involved in the stability and shape of the erythrocyte membrane (PubMed : 35835865). Glycophorin A is the major intrinsic membrane protein of the erythrocyte. The N-terminal glycosylated segment, which lies outside the erythrocyte membrane, has MN blood group receptors. Appears to be important for the function of SLC4A1 and is required for high activity of SLC4A1. May be involved in translocation of SLC4A1 to the plasma membrane.. (Microbial infection) Appears to be a receptor for Hepatitis A virus (HAV).. (Microbial infection) Receptor for P.falciparum erythrocyte-binding antigen 175 (EBA-175); binding of EBA-175 is dependent on sialic acid residues of the O-linked glycans.
See full target information GYPA

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com