JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259376

Recombinant human GM-CSF protein (Active)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant human GM-CSF protein (Active) is a Human Full Length protein, in the 18 to 144 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC, Cell Culture.

대체 명칭 보기

GMCSF, CSF2, Granulocyte-macrophage colony-stimulating factor, GM-CSF, Colony-stimulating factor, Molgramostin, Sargramostim, CSF

4 이미지
Mass Spectrometry - Recombinant human GM-CSF protein (Active) (AB259376)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human GM-CSF protein (Active) (AB259376)

M+/- 0 Da, pass (additional mass signals from glycan modifiactions : +203 Da HexNAc, +162 Da Hex)). Calc MW 14523.00 Da.

Functional Studies - Recombinant human GM-CSF protein (Active) (AB259376)
  • FuncS

Supplier Data

Functional Studies - Recombinant human GM-CSF protein (Active) (AB259376)

Fully biologicaly active as determined by dose-depended proliferation of TF-1 Cells.

ED50 is ≤ 0.1ng/mL, corresponding to a specific activity of 1.00 x 107 units/mg.

SDS-PAGE - Recombinant human GM-CSF protein (Active) (AB259376)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human GM-CSF protein (Active) (AB259376)

SDS-PAGE analysis of ab259376.

The protein is heavily glycosylated and therefore runs as a smear.

HPLC - Recombinant human GM-CSF protein (Active) (AB259376)
  • HPLC

Supplier Data

HPLC - Recombinant human GM-CSF protein (Active) (AB259376)

Purity 95% (sample was deglycosylated prior HPLC analysis; signal at RT 6.7 min corresponds to deglycosylation mix).

주요 정보

Purity

>95% SDS-PAGE

Purity by HPLC >=95%.

Endotoxin 레벨

<0.005 EU/µg

발현 시스템

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE, Cell Culture, HPLC, Mass Spec, FuncS

applications

Biologically active

Yes

Biological activity

Fully biologicaly active as determined by dose-depended proliferation of TF-1 Cells.

ED50 is ≤ 0.1ng/mL, corresponding to a specific activity of 1.00 x 107 units/mg.

Accession

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute with phosphate buffered saline.Store lyophilized form at room temperature. Reconstitute, aliquot and store at -80°C for 12 months or +4°C for 1 week.Avoid repeated freeze-thaw. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.

보관 버퍼

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment.

서열 정보

[{"linker":null,"sequence":"APARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQTITFESFKENLKDFLLVIPFDCWEPVQE","proteinLength":"Full Length","predictedMolecularWeight":"14.52 kDa","actualMolecularWeight":"14.52 kDa","aminoAcidEnd":144,"aminoAcidStart":18,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P04141","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient|-20°C
보관 정보
Avoid freeze / thaw cycle
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

GM-CSF also known as Granulocyte-Macrophage Colony-Stimulating Factor is a glycoprotein with a mass of approximately 23 kDa. This protein plays a mechanical role in stimulating the differentiation and proliferation of hematopoietic progenitor cells into granulocytes and macrophages. Its expression occurs in various cell types including macrophages T cells endothelial cells and fibroblasts. GM-CSF interacts with its specific receptor known as CSF2 receptor to exert its effects.
Biological function summary

GM-CSF influences the immune system by enhancing the functional capacity of mature neutrophils macrophages and eosinophils. GM-CSF protein acts alone and not as part of a larger protein complex. It is important in regulating immune responses and inflammation. Due to its role in promoting the survival and activation of these immune cells GM-CSF is important for mounting an effective immune defense in response to infections and other challenges.

Pathways

GM-CSF signaling is integral to the JAK-STAT pathway. This pathway is essential for transmitting signals from surface receptors like GM-CSF receptors into the nucleus thereby inducing gene expression that leads to cell survival and proliferation. GM-CSF also intersects with the ERK1/ERK2 MAPK pathway which is involved in regulating cellular processes such as division and differentiation. The GM-CSF receptor shares similarities with other cytokine receptors involved in these pathways making it related to various cytokines through its downstream signaling effects.

GM-CSF has a well-established connection to diseases like rheumatoid arthritis and multiple sclerosis. In rheumatoid arthritis overproduction of GM-CSF is linked to chronic inflammation and joint damage. In multiple sclerosis GM-CSF might contribute to the pathological immune responses against the central nervous system. Antibodies targeting GM-CSF or its receptor represent a therapeutic strategy for these autoimmune diseases. By modulating GM-CSF activity therapeutic approaches aim to reduce inflammation and autoimmunity highlighting the protein's importance in disease progression.

일반 정보

기능

Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.

서열 유사성

Belongs to the GM-CSF family.

제품 프로토콜

타겟 정보

Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
See full target information CSF2

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com