JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB131697

Recombinant Human Hemoglobin subunit alpha protein (denatured) (DDDDK tag N-Term + His tag N-Term)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Hemoglobin subunit alpha protein (denatured) (DDDDK tag N-Term + His tag N-Term) is a Human Full Length protein, in the 1 to 142 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

대체 명칭 보기

HBA2, HBA1, Hemoglobin subunit alpha, Alpha-globin, Hemoglobin alpha chain

3 이미지
Western blot - Recombinant Human Hemoglobin subunit alpha protein (denatured) (DDDDK tag N-Term + His tag N-Term) (AB131697)
  • WB

Lab

Western blot - Recombinant Human Hemoglobin subunit alpha protein (denatured) (DDDDK tag N-Term + His tag N-Term) (AB131697)

**Blocking/Dilution buffer : ** 5% NFDM/TBST.

All lanes:

Western blot - Anti-Hemoglobin subunit beta antibody [EPR20614] (<a href='/ko/products/primary-antibodies/hemoglobin-subunit-beta-antibody-epr20614-ab214049'>ab214049</a>) at 1/1000 dilution

Lane 1:

Western blot - Recombinant Human Hemoglobin subunit alpha protein (denatured) (DDDDK tag N-Term + His tag N-Term) (ab131697) at 0.01 µg

Lane 2:

His-tagged human Hemoglobin subunit beta/ba1 (aa3-147) recombinant protein at 0.01 µg

Lane 3:

His-tagged human Hemoglobin subunit delta (aa3-147) recombinant protein at 0.01 µg

Lane 4:

His-tagged human Hemoglobin subunit epsilon (aa3-147) recombinant protein at 0.01 µg

Lane 5:

His-tagged human Hemoglobin subunit Gamma-2 (aa2-147) recombinant protein at 0.01 µg

Lane 6:

His-tagged human Hemoglobin subunit Gamma-1 (aa2-147) recombinant protein at 0.01 µg

Lane 7:

Western blot - Recombinant Human Hemoglobin subunit zeta protein (His tag C-Terminus) (<a href='/ko/products/proteins-peptides/recombinant-human-hemoglobin-subunit-zeta-protein-ab95347'>ab95347</a>) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) (<a href='/ko/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-ab97051'>ab97051</a>) at 1/20000 dilution

Predicted band size: 16 kDa

Observed band size: 15 kDa

true

Exposure time: 3s

Western blot - Recombinant Human Hemoglobin subunit alpha protein (denatured) (DDDDK tag N-Term + His tag N-Term) (AB131697)
  • WB

Supplier Data

Western blot - Recombinant Human Hemoglobin subunit alpha protein (denatured) (DDDDK tag N-Term + His tag N-Term) (AB131697)

Blocking/Dilutiing buffer and concentration : 5% NFDM/TBST Exposure time : 100 seconds

All lanes:

Western blot - Anti-Hemoglobin subunit beta + Hemoglobin subunit delta antibody [EPR8322(B)] (<a href='/ko/products/primary-antibodies/hemoglobin-subunit-beta-hemoglobin-subunit-delta-antibody-epr8322b-ab131225'>ab131225</a>) at 1/200 dilution

Lane 1:

Western blot - Recombinant Human Hemoglobin subunit alpha protein (denatured) (DDDDK tag N-Term + His tag N-Term) (ab131697) at 0.1 µg

Lane 2:

His-tagged human Hemoglobin subunit beta/ba1 (aa 3-147) recombinant protein at 0.1 µg

Lane 3:

His-tagged human Hemoglobin subunit delta (aa 3-147) recombinant protein at 0.1 µg

Lane 4:

His-tagged full length human Hemoglobin subunit delta recombinant protein at 0.1 µg

Lane 5:

His-tagged human Hemoglobin subunit epsilon (aa 3-147) recombinant protein at 0.1 µg

Lane 6:

His-tagged human Hemoglobin subunit gamma-2 (aa 2-147) recombinant protein at 0.1 µg

Lane 7:

His-tagged human Hemoglobin subunit gamma-1 (aa 2-147) recombinant protein at 0.1 µg

Lane 8:

Western blot - Recombinant Human Hemoglobin subunit zeta protein (His tag C-Terminus) (<a href='/ko/products/proteins-peptides/recombinant-human-hemoglobin-subunit-zeta-protein-ab95347'>ab95347</a>) at 0.1 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) (<a href='/ko/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-ab97051'>ab97051</a>) at 1/20000 dilution

false

SDS-PAGE - Recombinant Human Hemoglobin subunit alpha protein (denatured) (DDDDK tag N-Term + His tag N-Term) (AB131697)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Hemoglobin subunit alpha protein (denatured) (DDDDK tag N-Term + His tag N-Term) (AB131697)

SDS-PAGE analysis of ab131697 (3 μg) under reducing conditions and visualized by coomassie blue stain.

주요 정보

Purity

>85% SDS-PAGE

ab131697 was purified using conventional chromatography techniques.

발현 시스템

Escherichia coli

Tags

DDDDK tag N-Terminus His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 12.01% Urea, 0.58% Sodium chloride, 0.32% Tris HCl, 0.03% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR","proteinLength":"Full Length","predictedMolecularWeight":"19.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":142,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P69905","tags":[{"tag":"DDDDK","terminus":"N-Terminus"},{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 기간
1-2 weeks
적절한 단기 보관 조건
+4°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Hemoglobin subunit alpha also known as alpha-globin is a component of the hemoglobin protein complex which plays an important role in oxygen transport within the blood. Alpha-globin has an approximate molecular weight of 15.1 kDa and is expressed highly in the red blood cells. It is part of the hemoglobin tetramer along with two beta subunits each one containing an iron-bound heme group. Variants of the alpha chain can be studied using hemoglobin peptides or denatured hemoglobin samples. Researchers can further analyze the alpha hemoglobin using methods like SDS-PAGE or alpha ELISA assays.
Biological function summary

Hemoglobin subunit alpha forms an important part of the hemoglobin complex facilitating the binding and release of oxygen molecules as blood circulates in the body. Alpha hemoglobin ensures efficient loading of oxygen in the lungs and unloading in tissues maintaining cellular respiration. The subunit plays a structural role as well stabilizing the hemoglobin tetramer for optimal function. Its ability to carry oxygen depends on the cooperative interaction between its alpha and beta globin counterparts.

Pathways

Hemoglobin subunit alpha operates predominantly within the oxygen transport pathway which is essential to meet the metabolic demands of cells. It also links to pathways involving iron metabolism given its coordination with heme groups. Alpha hemoglobin interacts cooperatively with proteins such as beta-globin to ensure efficient oxygen delivery. This interplay is highlighted when examining hemoglobin biosynthesis and breakdown pathways.

Alpha-globin is linked to conditions like alpha-thalassemia and sickle cell disease. These disorders result from mutations in the hemoglobin alpha or beta subunits leading to imbalanced globin production or abnormal hemoglobin structures. Alpha thalassemia is connected with unequal production of globin chains affecting hemoglobin stability while beta-globin mutations lead to sickle cell disease with altered oxygen delivery. Anti-hemoglobin antibodies might help in researching these conditions allowing a better understanding of molecular changes and potential therapeutic targets.

일반 정보

기능

Involved in oxygen transport from the lung to the various peripheral tissues.. Hemopressin. Hemopressin acts as an antagonist peptide of the cannabinoid receptor CNR1 (PubMed : 18077343). Hemopressin-binding efficiently blocks cannabinoid receptor CNR1 and subsequent signaling (PubMed : 18077343).

서열 유사성

Belongs to the globin family.

Post-translational modifications

The initiator Met is not cleaved in variant Thionville and is acetylated.

제품 프로토콜

타겟 정보

Involved in oxygen transport from the lung to the various peripheral tissues.. Hemopressin. Hemopressin acts as an antagonist peptide of the cannabinoid receptor CNR1 (PubMed : 18077343). Hemopressin-binding efficiently blocks cannabinoid receptor CNR1 and subsequent signaling (PubMed : 18077343).
See full target information HBA1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com