JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB158639

Recombinant Human Hemoglobin subunit beta protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Hemoglobin subunit beta protein (GST tag N-Terminus) is a Human Fragment protein, in the 38 to 147 aa range, expressed in Wheat germ, suitable for ELISA, WB.

대체 명칭 보기

Hemoglobin subunit beta, Beta-globin, Hemoglobin beta chain, HBB

1 이미지
SDS-PAGE - Recombinant Human Hemoglobin subunit beta protein (GST tag N-Terminus) (AB158639)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Hemoglobin subunit beta protein (GST tag N-Terminus) (AB158639)

ab158639 on a 12.5% SDS-PAGE stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

This product was previously labelled as Hemoglobin subunit beta.

서열 정보

[{"linker":null,"sequence":"WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":147,"aminoAcidStart":38,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P68871","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

The hemoglobin subunit beta also known as beta hemoglobin or hemoglobin beta subunit is a component of the larger hemoglobin molecule important for transporting oxygen in red blood cells. This protein has a molecular weight of approximately 16 kDa. Hemoglobin subunit beta joins with alpha hemoglobin subunit to form hemoglobin A the most common form in adult humans. Expression of this protein happens in the erythroid cells of the bone marrow where it plays an important role in the production of hemoglobin during red blood cell formation.
Biological function summary

The hemoglobin beta subunit is essential for binding and releasing oxygen to tissues throughout the body. As part of the hemoglobin complex it helps stabilize the oxygen binding affinity through cooperative interactions with the alpha subunits. When oxygen binds to the heme groups in these subunits a conformational change occurs enhancing the efficiency of oxygen transport. This dynamic action allows hemoglobin to carry oxygen from the lungs to tissues and return carbon dioxide for expulsion.

Pathways

Hemoglobin beta subunit significantly participates in the oxygen transport and carbon dioxide exchange pathways. It interacts closely with carbonic anhydrase in the process of carbon dioxide transport converting it to bicarbonate for efficient clearance from the body. In this capacity the protein stands as a central component of the erythrocyte function and blood gas transport system partnering physiologically with proteins such as cytochrome b5 reductase in electron transfer-related pathways.

Hemoglobin subunit beta is prominently associated with hemoglobinopathies like sickle cell disease and beta-thalassemia. Mutations in its gene can lead to abnormal hemoglobin function or structure causing red blood cell disorders that impact oxygen delivery. In sickle cell disease an amino acid substitution causes hemoglobin to polymerize under low oxygen resulting in sickle-shaped cells. In beta-thalassemia reduced or absent beta-globin chain production leads to anemia. These hemoglobin-related disorders are tightly connected to genetic mutations influencing other proteins such as alpha-globin complicating the clinical picture.

일반 정보

기능

Involved in oxygen transport from the lung to the various peripheral tissues.. LVV-hemorphin-7 potentiates the activity of bradykinin, causing a decrease in blood pressure.. Spinorphin. Functions as an endogenous inhibitor of enkephalin-degrading enzymes such as DPP3, and as a selective antagonist of the P2RX3 receptor which is involved in pain signaling, these properties implicate it as a regulator of pain and inflammation.

서열 유사성

Belongs to the globin family.

Post-translational modifications

Glucose reacts non-enzymatically with the N-terminus of the beta chain to form a stable ketoamine linkage. This takes place slowly and continuously throughout the 120-day life span of the red blood cell. The rate of glycation is increased in patients with diabetes mellitus.. S-nitrosylated; a nitric oxide group is first bound to Fe(2+) and then transferred to Cys-94 to allow capture of O(2).. Acetylated on Lys-60, Lys-83 and Lys-145 upon aspirin exposure.

제품 프로토콜

타겟 정보

Involved in oxygen transport from the lung to the various peripheral tissues.. LVV-hemorphin-7 potentiates the activity of bradykinin, causing a decrease in blood pressure.. Spinorphin. Functions as an endogenous inhibitor of enkephalin-degrading enzymes such as DPP3, and as a selective antagonist of the P2RX3 receptor which is involved in pain signaling, these properties implicate it as a regulator of pain and inflammation.
See full target information HBB

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com