JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB109962

Recombinant Human HMGB2 protein (His tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(1 출판물)

Recombinant Human HMGB2 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 209 aa range, expressed in Baculovirus infected insect cells, with >90%, suitable for SDS-PAGE.

대체 명칭 보기

HMG2, HMGB2, High mobility group protein B2, High mobility group protein 2, HMG-2

1 이미지
SDS-PAGE - Recombinant Human HMGB2 protein (His tag N-Terminus) (AB109962)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human HMGB2 protein (His tag N-Terminus) (AB109962)

15% SDS-PAGE analysis of 3μg ab109962.

주요 정보

Purity

>90% SDS-PAGE

Affinity purified

발현 시스템

Baculovirus infected insect cells

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 30% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.058% Sodium chloride, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MGSSHHHHHHSSGLVPRGSHTGSMGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE","proteinLength":"Full Length","predictedMolecularWeight":"26.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":209,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Baculovirus infected insect cells","accessionNumber":"P26583","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Affinity purification
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

일반 정보

기능

Multifunctional protein with various roles in different cellular compartments. May act in a redox sensitive manner. In the nucleus is an abundant chromatin-associated non-histone protein involved in transcription, chromatin remodeling and V(D)J recombination and probably other processes. Binds DNA with a preference to non-canonical DNA structures such as single-stranded DNA. Can bent DNA and enhance DNA flexibility by looping thus providing a mechanism to promote activities on various gene promoters by enhancing transcription factor binding and/or bringing distant regulatory sequences into close proximity (PubMed : 11909973, PubMed : 18413230, PubMed : 19522541, PubMed : 19965638, PubMed : 20123072, PubMed : 7797075). Involved in V(D)J recombination by acting as a cofactor of the RAG complex : acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS) (By similarity). Proposed to be involved in the innate immune response to nucleic acids by acting as a promiscuous immunogenic DNA/RNA sensor which cooperates with subsequent discriminative sensing by specific pattern recognition receptors (By similarity). In the extracellular compartment acts as a chemokine. Promotes proliferation and migration of endothelial cells implicating AGER/RAGE (PubMed : 19811285). Has antimicrobial activity in gastrointestinal epithelial tissues (PubMed : 23877675). Involved in inflammatory response to antigenic stimulus coupled with pro-inflammatory activity (By similarity). Involved in modulation of neurogenesis probably by regulation of neural stem proliferation (By similarity). Involved in articular cartilage surface maintenance implicating LEF1 and the Wnt/beta-catenin pathway (By similarity).

서열 유사성

Belongs to the HMGB family.

Post-translational modifications

Reduction/oxidation of cysteine residues Cys-23, Cys-45 and Cys-106 and a possible intramolecular disulfide bond involving Cys-23 and Cys-45 give rise to different redox forms with specific functional activities in various cellular compartments: 1- fully reduced HMGB2 (HMGB2C23hC45hC106h), 2- disulfide HMGB2 (HMGB2C23-C45C106h) and 3- sulfonyl HMGB2 (HMGB2C23soC45soC106so).. Acetylation enhances nucleosome binding and chromation remodeling activity.

Subcellular localisation

Nucleus

제품 프로토콜

타겟 정보

Multifunctional protein with various roles in different cellular compartments. May act in a redox sensitive manner. In the nucleus is an abundant chromatin-associated non-histone protein involved in transcription, chromatin remodeling and V(D)J recombination and probably other processes. Binds DNA with a preference to non-canonical DNA structures such as single-stranded DNA. Can bent DNA and enhance DNA flexibility by looping thus providing a mechanism to promote activities on various gene promoters by enhancing transcription factor binding and/or bringing distant regulatory sequences into close proximity (PubMed : 11909973, PubMed : 18413230, PubMed : 19522541, PubMed : 19965638, PubMed : 20123072, PubMed : 7797075). Involved in V(D)J recombination by acting as a cofactor of the RAG complex : acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS) (By similarity). Proposed to be involved in the innate immune response to nucleic acids by acting as a promiscuous immunogenic DNA/RNA sensor which cooperates with subsequent discriminative sensing by specific pattern recognition receptors (By similarity). In the extracellular compartment acts as a chemokine. Promotes proliferation and migration of endothelial cells implicating AGER/RAGE (PubMed : 19811285). Has antimicrobial activity in gastrointestinal epithelial tissues (PubMed : 23877675). Involved in inflammatory response to antigenic stimulus coupled with pro-inflammatory activity (By similarity). Involved in modulation of neurogenesis probably by regulation of neural stem proliferation (By similarity). Involved in articular cartilage surface maintenance implicating LEF1 and the Wnt/beta-catenin pathway (By similarity).
See full target information HMGB2

제품이 사용된 논문 (1)

Recent publications for all applications. Explore the 전체 목록 and refine your search

Cellular and molecular life sciences : CMLS 81:361 PubMed39158745

2024

An i-motif-regulated enhancer, eRNA and adjacent lncRNA affect Lhb expression through distinct mechanisms in a sex-specific context.

Applications

Unspecified application

Species

Unspecified reactive species

Tal Refael,Maya Sudman,Gil Golan,Lilach Pnueli,Sujay Naik,Ella Preger-Ben Noon,Arnon Henn,Ariel Kaplan,Philippa Melamed
제품이 사용된 논문 모두 보기

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com