JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB124602

Recombinant Human HP1 alpha protein (His tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human HP1 alpha protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 191 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

대체 명칭 보기

HP1A, CBX5, Chromobox protein homolog 5, Antigen p25, Heterochromatin protein 1 homolog alpha, HP1 alpha

1 이미지
SDS-PAGE - Recombinant Human HP1 alpha protein (His tag N-Terminus) (AB124602)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human HP1 alpha protein (His tag N-Terminus) (AB124602)

15% SDS-PAGE showing ab124602 (3 µg).

주요 정보

Purity

>90% SDS-PAGE

ab124602 is purified by using conventional chromatography techniques.

발현 시스템

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 30% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MGSSHHHHHHSSGLVPRGSHMGSHMGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS","proteinLength":"Full Length","predictedMolecularWeight":"24.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":191,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P45973","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 기간
1-2 weeks
적절한 단기 보관 조건
+4°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

HP1 alpha also known as HP1a or HP1 protein is a well-studied member of the heterochromatin protein 1 family. It plays a mechanical role in chromatin organization and gene regulation by binding to histone H3 when it's methylated at lysine 9 (H3K9me). This protein has a molecular mass of approximately 22-25 kDa. HP1 alpha is commonly expressed in the nuclei of eukaryotic cells where it localizes to heterochromatin regions and influences chromatin compaction.
Biological function summary

Heterochromatin protein 1 alpha acts as a modulator of gene silencing. It is part of a larger protein complex that contains various chromatin modifiers responsible for maintaining the silent state of certain genes. By mediating these interactions HP1 alpha helps regulate transcription replication timing and DNA repair processes. This regulation is essential for the structural maintenance of heterochromatin and plays a part in chromosomal stability.

Pathways

HP1 alpha is integral in the epigenetic regulation pathway along with other well-known proteins including SUV39H1 and SUV39H2 which are histone methyltransferases. HP1 alpha also links to the DNA damage response pathway where it recruits repair factors to maintain genomic integrity. Through these pathways HP1 alpha interacts closely with proteins like BRCA1 emphasizing its role in cellular homeostasis and response to DNA damage.

Researchers associate HP1 alpha with cancer and developmental disorders. Alterations in HP1 alpha expression or function can lead to disruptions in chromatin organization contributing to oncogenesis by affecting tumor suppressor genes. Furthermore HP1 alpha links to disorders like ICF syndrome through its relationship with the DNA methylation process where it interacts with proteins such as DNMT3B. Understanding these connections provides insights into therapeutic approaches targeting epigenetic modifications in disease contexts.

일반 정보

기능

Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression (PubMed : 40440427). In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph) (PubMed : 19783980). Also recognizes and binds histone H1.4 methylated at 'Lys-26' (H1.4K26me) (PubMed : 16127177). Excluded from chromatin when histone H1.4 is Simultaneously methylated at Lys-26 (H1.4K26me) and phosphorylated at Ser-27 (H1.4S27Ph) (PubMed : 16127177). May contribute to the association of heterochromatin with the inner nuclear membrane by interactions with the lamin-B receptor (LBR) (PubMed : 19783980). Involved in the formation of kinetochore through interaction with the MIS12 complex subunit NSL1 (PubMed : 19783980, PubMed : 20231385). Required for the formation of the inner centromere (PubMed : 20231385).

Post-translational modifications

Phosphorylation of HP1 and LBR may be responsible for some of the alterations in chromatin organization and nuclear structure which occur at various times during the cell cycle (By similarity). Phosphorylated during interphase and possibly hyper-phosphorylated during mitosis.. Ubiquitinated.

Subcellular localisation

Nucleus

제품 프로토콜

타겟 정보

Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression (PubMed : 40440427). In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph) (PubMed : 19783980). Also recognizes and binds histone H1.4 methylated at 'Lys-26' (H1.4K26me) (PubMed : 16127177). Excluded from chromatin when histone H1.4 is Simultaneously methylated at Lys-26 (H1.4K26me) and phosphorylated at Ser-27 (H1.4S27Ph) (PubMed : 16127177). May contribute to the association of heterochromatin with the inner nuclear membrane by interactions with the lamin-B receptor (LBR) (PubMed : 19783980). Involved in the formation of kinetochore through interaction with the MIS12 complex subunit NSL1 (PubMed : 19783980, PubMed : 20231385). Required for the formation of the inner centromere (PubMed : 20231385).
See full target information CBX5

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com