JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB239546

Recombinant Human HSPC152 protein (Tagged)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human HSPC152 protein (Tagged) is a Human Full Length protein, in the 1 to 125 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

대체 명칭 보기

AD-001, HSPC152, HSPC170, TRMT112, Multifunctional methyltransferase subunit TRM112-like protein, tRNA methyltransferase 112 homolog

3 이미지
Mass Spectrometry - Recombinant Human HSPC152 protein (Tagged) (AB239546)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human HSPC152 protein (Tagged) (AB239546)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab239546 could indicate that this peptide derived from E.coli-expressed Human HSPC152.

Mass Spectrometry - Recombinant Human HSPC152 protein (Tagged) (AB239546)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human HSPC152 protein (Tagged) (AB239546)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab239546 could indicate that this peptide derived from E.coli-expressed human HSPC152 .

SDS-PAGE - Recombinant Human HSPC152 protein (Tagged) (AB239546)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human HSPC152 protein (Tagged) (AB239546)

ab239546 analysis by (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

주요 정보

Purity

>90% SDS-PAGE

발현 시스템

Escherichia coli

Tags

6x His tag N-Terminus SUMO tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES","proteinLength":"Full Length","predictedMolecularWeight":"30.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":125,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9UI30","tags":[{"tag":"6x His","terminus":"N-Terminus"},{"tag":"SUMO","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

HSPC152 also known as C19orf53 plays a role in various cellular processes. It has a molecular mass of approximately 14 kDa. Researchers have found this protein expressed in a wide range of human tissues with significant presence noted in organs such as the brain and liver. While specific subcellular localization can vary evidence suggests that HSPC152 predominantly resides in the cytoplasm.
Biological function summary

HSPC152 contributes to cellular homeostasis and regulation at multiple levels. While its standalone functions remain under investigation it is often involved as part of larger protein complexes. Studies have shown that it might interact with other proteins to influence cell cycle regulation implicating its potential role in maintaining cellular balance and responding to external stimuli.

Pathways

HSPC152 is associated with the regulatory processes in cell proliferation and apoptosis. It is speculated to interact within pathways such as the PI3K-Akt signaling pathway which is essential for cell survival. Connections between HSPC152 and proteins such as Akt and mTOR suggest it may contribute to modulating these pathways impacting varied cellular responses in different tissues.

Understanding the functions of HSPC152 extends to cancer and neurodegenerative conditions. Altered expression of HSPC152 has been observed in certain cancers hinting at its potential involvement in tumorigenesis. Furthermore its interaction with proteins like p53 known for roles in both cancer and neurodegenerative disease pathways suggests that further study may help in understanding the influence HSPC152 has in these contexts.

일반 정보

기능

Acts as an activator of both rRNA/tRNA and protein methyltransferases (PubMed : 18539146, PubMed : 20308323, PubMed : 25851604, PubMed : 31061526, PubMed : 31328227, PubMed : 31636962, PubMed : 37283053). Together with methyltransferase BUD23, methylates the N(7) position of a guanine in 18S rRNA (PubMed : 25851604). The heterodimer with N6AMT1/HEMK2 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor (PubMed : 18539146, PubMed : 31061526, PubMed : 31636962). The heterodimer with N6AMT1/HEMK2 also monomethylates 'Lys-12' of histone H4 (H4K12me1) (PubMed : 31061526). The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species (PubMed : 20308323). Together with methyltransferase THUMPD3, catalyzes the formation of N(2)-methylguanosine at position 6 in a broad range of tRNA substrates and at position 7 of tRNA(Trp) (PubMed : 34669960, PubMed : 37283053). Involved in the pre-rRNA processing steps leading to small-subunit rRNA production (PubMed : 25851604). Together with methyltransferase METTL5, specifically methylates the 6th position of adenine in position 1832 of 18S rRNA (PubMed : 31328227, PubMed : 33428944, PubMed : 35033535, PubMed : 37283053).

서열 유사성

Belongs to the TRM112 family.

제품 프로토콜

타겟 정보

Acts as an activator of both rRNA/tRNA and protein methyltransferases (PubMed : 18539146, PubMed : 20308323, PubMed : 25851604, PubMed : 31061526, PubMed : 31328227, PubMed : 31636962, PubMed : 37283053). Together with methyltransferase BUD23, methylates the N(7) position of a guanine in 18S rRNA (PubMed : 25851604). The heterodimer with N6AMT1/HEMK2 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor (PubMed : 18539146, PubMed : 31061526, PubMed : 31636962). The heterodimer with N6AMT1/HEMK2 also monomethylates 'Lys-12' of histone H4 (H4K12me1) (PubMed : 31061526). The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species (PubMed : 20308323). Together with methyltransferase THUMPD3, catalyzes the formation of N(2)-methylguanosine at position 6 in a broad range of tRNA substrates and at position 7 of tRNA(Trp) (PubMed : 34669960, PubMed : 37283053). Involved in the pre-rRNA processing steps leading to small-subunit rRNA production (PubMed : 25851604). Together with methyltransferase METTL5, specifically methylates the 6th position of adenine in position 1832 of 18S rRNA (PubMed : 31328227, PubMed : 33428944, PubMed : 35033535, PubMed : 37283053).
See full target information TRMT112

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com